Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.71
PubTator Score 1.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.300 6.4e-03
cutaneous lupus erythematosus -1.100 3.2e-03
group 3 medulloblastoma -1.700 7.2e-04
intraductal papillary-mucinous neoplasm ... -1.300 9.6e-04
malignant mesothelioma 1.200 6.7e-05
ovarian cancer -1.600 8.8e-04
psoriasis -1.300 5.4e-08
subependymal giant cell astrocytoma -1.120 7.0e-03
tuberculosis and treatment for 6 months -1.100 1.0e-05

AA Sequence

MVLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKASFATPYGYAMETAKQKALEVA      1 - 70
NRLYQKDLRAPDVVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTR     71 - 140
VSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVK    141 - 210
LYYPPRPEDLRRSVKHDSIPAADTFEDLSDVEGGGSEPTQRDAGSRDEKAEAGEAGQATAEAECHRTRET    211 - 280
LPPFPTRLLELIEGFMLSKGLLTACKLKVFDLLKDEAPQKAADIASKVDASACGMERLLDICAAMGLLEK    281 - 350
TEQGYSNTETANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQDAYYQ    351 - 420
SPETRLRFMRAMHGMTKLTACQVATAFNLSRFSSACDVGGCTGALARELAREYPRMQVTVFDLPDIIELA    421 - 490
AHFQPPGPQAVQIHFAAGDFFRDPLPSAELYVLCRILHDWPDDKVHKLLSRVAESCKPGAGLLLVETLLD    491 - 560
EEKRVAQRALMQSLNMLVQTEGKERSLGEYQCLLELHGFHQVQVVHLGGVLDAILATKVAP             561 - 621
//

Text Mined References (22)

PMID Year Title