Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.34
PubTator Score 1.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Leukemia, Myelocytic, Acute 113
Disease Target Count P-value
psoriasis 6685 5.36551155418123E-8
group 4 medulloblastoma 1875 1.12289368538744E-6
malignant mesothelioma 3163 2.64060843157915E-6
tuberculosis and treatment for 6 months 686 1.01211334606965E-5
ovarian cancer 8492 5.95095352391705E-4
cutaneous lupus erythematosus 1056 0.00318031086654757
astrocytoma 1493 0.00641280045503998
subependymal giant cell astrocytoma 2287 0.00702279895562658
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00824892863915532
Disease Target Count Z-score Confidence
Patau syndrome 15 3.394 1.7
Carney complex 23 3.071 1.5

Expression

  Differential Expression (9)

Synonym

Accession O95671 B4DX75 F5GXH4 J3JS33 Q5JQ53 Q8NBH5 Q96G02 Q9BUL6 ASMTL
Symbols ASTML
ASMTLX
ASMTLY

Gene

PANTHER Protein Class (2)

PDB

2P5X  

  Ortholog (8)

Species Source
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid

AA Sequence

MVLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKASFATPYGYAMETAKQKALEVA      1 - 70
NRLYQKDLRAPDVVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTR     71 - 140
VSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVK    141 - 210
LYYPPRPEDLRRSVKHDSIPAADTFEDLSDVEGGGSEPTQRDAGSRDEKAEAGEAGQATAEAECHRTRET    211 - 280
LPPFPTRLLELIEGFMLSKGLLTACKLKVFDLLKDEAPQKAADIASKVDASACGMERLLDICAAMGLLEK    281 - 350
TEQGYSNTETANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQDAYYQ    351 - 420
SPETRLRFMRAMHGMTKLTACQVATAFNLSRFSSACDVGGCTGALARELAREYPRMQVTVFDLPDIIELA    421 - 490
AHFQPPGPQAVQIHFAAGDFFRDPLPSAELYVLCRILHDWPDDKVHKLLSRVAESCKPGAGLLLVETLLD    491 - 560
EEKRVAQRALMQSLNMLVQTEGKERSLGEYQCLLELHGFHQVQVVHLGGVLDAILATKVAP             561 - 621
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...