Property Summary

NCBI Gene PubMed Count 28
PubMed Score 6.05
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
astrocytoma -2.200 0.006
posterior fossa group A ependymoma -3.500 0.000
glioblastoma -3.700 0.001
oligodendroglioma -1.500 0.000
medulloblastoma -2.100 0.001
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.200 0.000
Parkinson's disease -1.200 0.045
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -1.500 0.000
subependymal giant cell astrocytoma -4.051 0.011
lung carcinoma 2.200 0.000
Alzheimer's disease -1.200 0.033
Pick disease -2.200 0.000
pituitary cancer 1.100 0.000

Synonym

Accession O95670 B5MEF0 Q2L6F8 Q5HYU8 Q5RJ63 V-ATPase subunit G 2
Symbols NG38
ATP6G
VMA10
ATP6G2

Gene

Gene RIF (5)

PMID Text
20854863 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLS      1 - 70
AEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA                           71 - 118
//

Text Mined References (30)

PMID Year Title
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
20854863 2010 Characterization of tumor necrosis factor-? block haplotypes associated with susceptibility to chronic venous leg ulcers in Caucasian patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16971954 2006 Haplotype-specific gene expression profiles in a telomeric major histocompatibility complex gene cluster and susceptibility to autoimmune diseases.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
More...