Property Summary

NCBI Gene PubMed Count 28
PubMed Score 7.05
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -3.100 1.0e-06
Alzheimer's disease -1.200 3.3e-02
astrocytic glioma -2.000 3.2e-03
Astrocytoma, Pilocytic -1.600 9.9e-06
atypical teratoid / rhabdoid tumor -4.200 7.6e-11
ependymoma -3.200 2.5e-02
glioblastoma -2.700 5.5e-09
group 3 medulloblastoma -1.700 1.0e-02
lung carcinoma 2.200 5.3e-48
malignant mesothelioma -1.400 1.8e-04
medulloblastoma, large-cell -3.500 5.9e-08
oligodendroglioma -1.500 8.7e-12
Parkinson's disease -1.200 4.5e-02
Pick disease -2.200 2.5e-04
pituitary cancer 1.100 2.6e-05
primitive neuroectodermal tumor -2.200 7.9e-05
subependymal giant cell astrocytoma -4.051 1.1e-02

Gene RIF (5)

AA Sequence

MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLS      1 - 70
AEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA                           71 - 118
//

Text Mined References (30)

PMID Year Title