Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 2
Funding $1,005,041.17
PubMed Score 27.25
PubTator Score 20.92

Knowledge Summary

Patent (2,938)

Expression

  Differential Expression (10)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588495 confirmatory 13 / 0 / 109 SAR analysis of small molecule NTR1 agonists in a image based NTR2 selectivity assay
602334 confirmatory 20 / 0 / 67 SAR analysis of small molecule NTR1 agonists in a image based NTR2 selectivity assay set 2

Gene RIF (10)

PMID Text
26298774 high expression of NTSR1 is found in clinical NETs and promoter methylation is an important mechanism controlling the differential expression of NTSR1 and silencing of NTSR2 in NET cells
23109725 NTSR2 was overexpressed, NTSR1 decreased, and neurotensin was not expressed in B cell leukemia patient's B-cells, as compared with healthy B cells.
20468071 Observational study of gene-disease association. (HuGE Navigator)
20048080 NTR2 and NTR3 were upregulated in prostate cancer cells with luminal phenotype (cytokeratin 18+)
19968961 this study proposes a novel function of NTR2 in the regulation of NTR1 activity.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18624930 NTR1 and NTR2 mRNA were not detected in either pituitary adenomas or normal tissue.
15383539 ghrelin receptor, neurotensin receptor 2 and GPR39 display an unusually high degree of constitutive activity, determined by an aromatic cluster on the inner face of the extracellular ends of TMs VI and VII
11801734 Recycling ability depends on a single tyrosine residue

AA Sequence

METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRH      1 - 70
HVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQP     71 - 140
LRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVN    141 - 210
VLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSL    211 - 280
VRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVS    281 - 350
SAVTPLLYNAVSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT              351 - 410
//

Text Mined References (22)

PMID Year Title
26298774 2015 Differential expression and tumorigenic function of neurotensin receptor 1 in neuroendocrine tumor cells.
23109725 2012 Differential expression of neurotensin and specific receptors, NTSR1 and NTSR2, in normal and malignant human B lymphocytes.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20048080 2010 Altered expression of neurotensin receptors is associated with the differentiation state of prostate cancer.
19968961 2010 Intermolecular cross-talk between NTR1 and NTR2 neurotensin receptor promotes intracellular sequestration and functional inhibition of NTR1 receptors.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18624930 2008 Expression of neurotensin and its receptors in pituitary adenomas.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...