Property Summary

NCBI Gene PubMed Count 49
Grant Count 23
R01 Count 16
Funding $6,834,436.41
PubMed Score 76.54
PubTator Score 102.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (45)

PMID Text
26832224 Transcriptional, but not post-transcriptional, silencing of GNG12-AS1 causes concomitant upregulation of DIRAS3, indicating a function in transcriptional interference.
26247722 ARHI-mediated autophagy-associated cell death enhances chemosensitivity to cisplatin in ovarian cancer cell lines and xenografts.
26165148 ARHI mRNA and protein expression is markedly decreased in osteosarcoma MG-63 cells lines. Overexpression of ARHI inhibits cell viability and proliferation.
26143066 In Title.
25675421 Letter: ARHI suppresses pancreatic cancer by regulating ERK 1/2 signaling.
25499977 ARHI competes with RanGTPase and interacts with importin beta via basic-acidic patch interaction, which leads to inhibition of STAT3 translocation.
25193278 JMJD2A-dependent silencing of Sp1 in advanced breast cancer promotes metastasis by downregulation of DIRAS3.
25077680 EZH2-''induced H3K27me3 is associated with epigenetic repression of the ARHI tumor-suppressor gene in epithelial ovarian cancer
24879154 suggest that DIRAS3 not only regulates the autophagosome initiation complex, but induces autophagy in dormant, nutrient-deprived ovarian cancer cells that remain after conventional chemotherapy, facilitating their survival
24769729 ARHI is required for autophagy-meditated cancer cell arrest and ARHI inhibits signaling through PI3K/AKT and Ras/MAP by enhancing internalization and degradation of the epidermal growth factor receptor.
More...

AA Sequence

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI      1 - 70
ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN     71 - 140
NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE    141 - 210
KKSQMPNTTEKLLDKCIIM                                                       211 - 229
//

Text Mined References (49)

PMID Year Title
26832224 2016 Transcriptional silencing of long noncoding RNA GNG12-AS1 uncouples its transcriptional and product-related functions.
26247722 2015 ARHI (DIRAS3)-mediated autophagy-associated cell death enhances chemosensitivity to cisplatin in ovarian cancer cell lines and xenografts.
26165148 2015 Aplasia Ras homologue member ? overexpression inhibits tumor growth and induces apoptosis through inhibition of PI3K/Akt survival pathways in human osteosarcoma MG-63 cells in culture.
26143066 2015 Somatic Mutation of ARHI Gene in Hepatocellular Carcinomas.
25675421 2015 ARHI suppresses pancreatic cancer by regulating MAPK/ERK 1/2 pathway.
25499977 2015 Structural perspective of ARHI mediated inhibition of STAT3 signaling: an insight into the inactive to active transition of ARHI and its interaction with STAT3 and importin?.
25193278 2014 JMJD2A-dependent silencing of Sp1 in advanced breast cancer promotes metastasis by downregulation of DIRAS3.
25077680 2015 EZH2-induced H3K27me3 is associated with epigenetic repression of the ARHI tumor-suppressor gene in ovarian cancer.
24879154 2014 DIRAS3 regulates the autophagosome initiation complex in dormant ovarian cancer cells.
24769729 2014 ARHI (DIRAS3) induces autophagy in ovarian cancer cells by downregulating the epidermal growth factor receptor, inhibiting PI3K and Ras/MAP signaling and activating the FOXo3a-mediated induction of Rab7.
More...