Property Summary

NCBI Gene PubMed Count 100
Grant Count 234
R01 Count 174
Funding $25,365,348.78
PubMed Score 451.35
PubTator Score 208.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95631 E9KL51
Symbols NTN1L

Gene

PDB

4URT  

Gene RIF (84)

PMID Text
27031829 Netrin-1 enhanced infectivity of hepatitis C virus particles and promoted viral entry by increasing the activation and decreasing the recycling of the epidermal growth factor receptor (EGFR), a protein that is dysregulated in hepatocellular carcinoma.
26859457 identify the V-2 domain of netrin-1 to be important for its interaction with the Ig1/Ig2 domains of UNC5H2
26573873 Akt-FoxO1 signaling pathway plays an essential role during liver regeneration
26393880 MUC4 has a role in promoting neural invasion mediated by the axon guidance factor Netrin-1 in pancreatic ductal adenocarcinoma
26039999 Netrin-1 stimulates phosphatase 1A to dephosphorylate YAP, which leads to decreased ubiquitination and degradation, enhancing YAP accumulation and signaling
25950802 NTN1-DCC pathway contains targets of FDA-approved drugs and may offer promise for guiding applied clinical research on preventive and therapeutic interventions for AMD
25903786 results demonstrate that netrin 1 is an important regulator of blood-brain barrier maintenance that protects the central nervous system against inflammatory conditions such as multiple sclerosis.
25569157 Investigation of the mechanisms that trigger local translation revealed a role for calcium-dependent retrograde netrin-1/DCC receptor signaling.
25483983 These results identify Netrin-1 as a key regulator of osteoclast differentiation that may be a new target for bone therapies.
25353184 Careful phenotyping of patients combined with molecular and functional studies in zebrafish identifed netrin-1 as a potential shared genetic factor for cardiac and thyroid congenital defects.
More...

AA Sequence

MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTC      1 - 70
GRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGK     71 - 140
KFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHTDM    141 - 210
RPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQ    211 - 280
VGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRC    281 - 350
RFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT    351 - 420
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKY    421 - 490
CKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGN    491 - 560
AEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA                              561 - 604
//

Text Mined References (101)

PMID Year Title
27031829 2016 Epidermal Growth Factor Receptor-Dependent Mutual Amplification between Netrin-1 and the Hepatitis C Virus.
26859457 2016 Structural Decoding of the Netrin-1/UNC5 Interaction and its Therapeutical Implications in Cancers.
26573873 2016 The neuroimmune guidance cue netrin-1 controls resolution programs and promotes liver regeneration.
26393880 2015 MUC4-promoted neural invasion is mediated by the axon guidance factor Netrin-1 in PDAC.
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
26039999 2015 Netrin-1 exerts oncogenic activities through enhancing Yes-associated protein stability.
25950802 2015 Netrin-1 - DCC Signaling Systems and Age-Related Macular Degeneration.
25903786 2015 Netrin 1 regulates blood-brain barrier function and neuroinflammation.
25569157 2015 Neuron-wide RNA transport combines with netrin-mediated local translation to spatially regulate the synaptic proteome.
25483983 2015 Netrin-1 is a critical autocrine/paracrine factor for osteoclast differentiation.
More...