Property Summary

NCBI Gene PubMed Count 117
PubMed Score 504.69
PubTator Score 208.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.700 1.8e-04
astrocytic glioma 2.000 1.0e-03
Astrocytoma, Pilocytic 3.300 6.4e-11
atypical teratoid / rhabdoid tumor 2.100 7.3e-03
ependymoma 2.100 8.6e-03
glioblastoma 1.800 7.4e-06
oligodendroglioma 1.700 2.6e-03
pancreatic ductal adenocarcinoma liver m... -1.349 2.4e-03
primitive neuroectodermal tumor 2.300 2.1e-02
psoriasis -1.200 1.5e-31
sonic hedgehog group medulloblastoma 2.200 1.8e-04

Protein-protein Interaction (2)

Gene RIF (100)

AA Sequence

MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTC      1 - 70
GRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGK     71 - 140
KFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHTDM    141 - 210
RPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQ    211 - 280
VGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRC    281 - 350
RFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT    351 - 420
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKY    421 - 490
CKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGN    491 - 560
AEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA                              561 - 604
//

Text Mined References (118)

PMID Year Title