Property Summary

NCBI Gene PubMed Count 100
PubMed Score 451.35
PubTator Score 208.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 1.51478333158441E-31
glioblastoma multiforme 347 6.88543232768007E-22
pilocytic astrocytoma 3086 6.83549891237837E-11
sonic hedgehog group medulloblastoma 1482 1.78707954539527E-4
astrocytic glioma 2241 9.96012250452335E-4
pediatric high grade glioma 2712 0.00175242819611893
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00243933268330896
oligodendroglioma 2849 0.00260985359447549
atypical teratoid / rhabdoid tumor 4369 0.00734103050993534
ependymoma 2514 0.00857468691509401
primitive neuroectodermal tumor 3031 0.0212937853774871
Disease Target Count Z-score Confidence
Colorectal Cancer 62 5.406 2.7
Vascular disease 281 3.097 1.5

Expression

Synonym

Accession O95631 E9KL51
Symbols NTN1L

Gene

PDB

4URT  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (84)

PMID Text
27031829 Netrin-1 enhanced infectivity of hepatitis C virus particles and promoted viral entry by increasing the activation and decreasing the recycling of the epidermal growth factor receptor (EGFR), a protein that is dysregulated in hepatocellular carcinoma.
26859457 identify the V-2 domain of netrin-1 to be important for its interaction with the Ig1/Ig2 domains of UNC5H2
26573873 Akt-FoxO1 signaling pathway plays an essential role during liver regeneration
26393880 MUC4 has a role in promoting neural invasion mediated by the axon guidance factor Netrin-1 in pancreatic ductal adenocarcinoma
26039999 Netrin-1 stimulates phosphatase 1A to dephosphorylate YAP, which leads to decreased ubiquitination and degradation, enhancing YAP accumulation and signaling
25950802 NTN1-DCC pathway contains targets of FDA-approved drugs and may offer promise for guiding applied clinical research on preventive and therapeutic interventions for AMD
25903786 results demonstrate that netrin 1 is an important regulator of blood-brain barrier maintenance that protects the central nervous system against inflammatory conditions such as multiple sclerosis.
25569157 Investigation of the mechanisms that trigger local translation revealed a role for calcium-dependent retrograde netrin-1/DCC receptor signaling.
25483983 These results identify Netrin-1 as a key regulator of osteoclast differentiation that may be a new target for bone therapies.
25353184 Careful phenotyping of patients combined with molecular and functional studies in zebrafish identifed netrin-1 as a potential shared genetic factor for cardiac and thyroid congenital defects.
More...

AA Sequence

MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTC      1 - 70
GRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGK     71 - 140
KFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHTDM    141 - 210
RPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQ    211 - 280
VGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRC    281 - 350
RFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT    351 - 420
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKY    421 - 490
CKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGN    491 - 560
AEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA                              561 - 604
//

Text Mined References (101)

PMID Year Title
27031829 2016 Epidermal Growth Factor Receptor-Dependent Mutual Amplification between Netrin-1 and the Hepatitis C Virus.
26859457 2016 Structural Decoding of the Netrin-1/UNC5 Interaction and its Therapeutical Implications in Cancers.
26573873 2016 The neuroimmune guidance cue netrin-1 controls resolution programs and promotes liver regeneration.
26393880 2015 MUC4-promoted neural invasion is mediated by the axon guidance factor Netrin-1 in PDAC.
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
26039999 2015 Netrin-1 exerts oncogenic activities through enhancing Yes-associated protein stability.
25950802 2015 Netrin-1 - DCC Signaling Systems and Age-Related Macular Degeneration.
25903786 2015 Netrin 1 regulates blood-brain barrier function and neuroinflammation.
25569157 2015 Neuron-wide RNA transport combines with netrin-mediated local translation to spatially regulate the synaptic proteome.
25483983 2015 Netrin-1 is a critical autocrine/paracrine factor for osteoclast differentiation.
More...