Property Summary

NCBI Gene PubMed Count 54
PubMed Score 43.53
PubTator Score 34.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
glioblastoma 5792 4.1e-06
adult high grade glioma 3801 1.7e-04
osteosarcoma 7950 1.9e-04
ovarian cancer 8520 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nager acrofacial dysostosis 21 3.361 1.7
Congenital hypothyroidism 26 3.007 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.100 1.7e-04
glioblastoma 1.100 4.1e-06
osteosarcoma -1.140 1.9e-04
ovarian cancer 1.400 1.0e-02

Gene RIF (20)

AA Sequence

MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF      1 - 70
IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ     71 - 140
ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT    141 - 210
LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE    211 - 280
TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH    281 - 350
THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI    351 - 420
TDLR                                                                      421 - 424
//

Text Mined References (56)

PMID Year Title