Property Summary

NCBI Gene PubMed Count 51
Grant Count 83
R01 Count 59
Funding $4,775,246.65
PubMed Score 41.89
PubTator Score 34.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.140 0.000
glioblastoma 1.100 0.000
adult high grade glioma 1.100 0.000
ovarian cancer 1.400 0.010

Synonym

Accession O95630 B5M0B6 D6W5H7 Q3MJE7
Symbols AMSH
MICCAP

Gene

PANTHER Protein Class (2)

PDB

2XZE   3RZU   3RZV  

Gene RIF (19)

PMID Text
26601948 The VHS domain of STAM2 directs AMSH to cleave longer Lys63-linked ubiquitin chains
25692795 Two siblings with classic features of MIC-CAP syndrome that harbor a novel predicted splice mutation in STAMBP
25070368 associated molecule with the SH3 domain of STAM-mediated deubiquitination of connexin 43 protects Gap junctions from degradation
24151880 Recognition of the proximal ubiquitin is imperative for the linkage specificity and catalytic efficiency of AMSH.
23542699 Mutations in STAMBP, encoding a deubiquitinating enzyme, cause microcephaly-capillary malformation syndrome.
22800866 AMSH efficiently removes ubiquitin from the activated EGFR.
21827950 tight coupling of ESCRT-III CHMP3 and AMSH functions and provide insight into the regulation of ESCRT-III
21448666 Studies indicate that USP8/Ubpy and AMSH interact with ESCRT components to modulate the ubiquitination status of receptors and relevant sorting proteins.
20159979 AMSH interacts with ESCRT-0 to regulate the stability and trafficking of CXCR4.
19684015 Data suggest that AMSH and UBPY are essential for trafficking and down-regulation of PAR(2) but not for regulating PAR(2) dissociation from beta-arrestin2 or PAR(2)-mediated ERK2 activation.
More...

AA Sequence

MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF      1 - 70
IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ     71 - 140
ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT    141 - 210
LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE    211 - 280
TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH    281 - 350
THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI    351 - 420
TDLR                                                                      421 - 424
//

Text Mined References (54)

PMID Year Title
26601948 2016 The Vps27/Hrs/STAM (VHS) Domain of the Signal-transducing Adaptor Molecule (STAM) Directs Associated Molecule with the SH3 Domain of STAM (AMSH) Specificity to Longer Ubiquitin Chains and Dictates the Position of Cleavage.
25692795 2015 Novel STAMBP mutation and additional findings in an Arabic family.
25416956 2014 A proteome-scale map of the human interactome network.
25070368 2014 AMSH-mediated deubiquitination of Cx43 regulates internalization and degradation of gap junctions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24151880 2013 Mechanism of recruitment and activation of the endosome-associated deubiquitinase AMSH.
23542699 2013 Mutations in STAMBP, encoding a deubiquitinating enzyme, cause microcephaly-capillary malformation syndrome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22800866 2012 Recycling of EGFR and ErbB2 is associated with impaired Hrs tyrosine phosphorylation and decreased deubiquitination by AMSH.
More...