Property Summary

NCBI Gene PubMed Count 18
PubMed Score 405.79
PubTator Score 16.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Adenoiditis 5 3.33 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.300 1.1e-02
atypical teratoid / rhabdoid tumor 1.200 1.8e-04
Gaucher disease type 1 -1.400 2.3e-02
glioblastoma 1.400 3.2e-03
group 3 medulloblastoma 1.200 3.5e-03
medulloblastoma, large-cell -1.600 5.4e-05
osteosarcoma -1.530 1.6e-06
ovarian cancer -1.100 5.5e-04
psoriasis -1.300 1.3e-03

Gene RIF (6)

AA Sequence

MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL      1 - 70
SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK     71 - 140
VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC    141 - 210
MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPS    211 - 280
DSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSG    281 - 350
LPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE    351 - 420
KELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFS    421 - 490
FPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHS    491 - 560
LQQGQQPTSLHTTVA                                                           561 - 575
//

Text Mined References (25)

PMID Year Title