Property Summary

NCBI Gene PubMed Count 17
Grant Count 12
R01 Count 10
Funding $1,074,080.23
PubMed Score 387.71
PubTator Score 16.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.300 0.001
osteosarcoma -1.530 0.000
astrocytoma 1.300 0.011
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.400 0.003
group 4 medulloblastoma 1.800 0.001
medulloblastoma, large-cell -1.600 0.000
ovarian cancer 1.900 0.001
Gaucher disease type 1 -1.400 0.023

Gene RIF (6)

PMID Text
25933433 CNOT4 controls the degradation of chromatin-unbound PAF1 via the 26S proteasome.
25663449 Single nucleotide polymorphism in CNOT4 gene is associated with osteosarcoma susceptibility.
22159038 Data show that Not4/CNOT4 is a novel positive regulator of the JAK/STAT pathway in Drosophila and in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19558367 Data show that Ccr4-Not function in RNA splicing and nuclear export, and that CNOT4 binds CNOT1 in yeast two-hybrid assays.
15001359 Data show that binding of the CNOT4 RING finger to the ubiquitin-conjugating enzyme (E2) UbcH5B is highly selective

AA Sequence

MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL      1 - 70
SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK     71 - 140
VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC    141 - 210
MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPS    211 - 280
DSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSG    281 - 350
LPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE    351 - 420
KELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFS    421 - 490
FPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHS    491 - 560
LQQGQQPTSLHTTVA                                                           561 - 575
//

Text Mined References (24)

PMID Year Title
25933433 2015 Protein Degradation of RNA Polymerase II-Association Factor 1(PAF1) Is Controlled by CNOT4 and 26S Proteasome.
25663449 2015 Polymorphisms in miRNA processing genes and their role in osteosarcoma risk.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22159038 2012 Not4 enhances JAK/STAT pathway-dependent gene expression in Drosophila and in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
More...