Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.35
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANLPKLNKLKKLE      1 - 70
LSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDLFTCEVTNLNNY              71 - 131
//

Text Mined References (11)

PMID Year Title