Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $21,400
PubMed Score 2.35
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26112988 results highlight that certain malignancies with ANP32C/D overexpression or mutation might be specifically targeted using Hsp90 inhibitors.
25225945 results provide independent evidence in support of a role for SENP1 in chronic mountain sickness in individuals of Quechua ancestry and suggest the SENP1 and ANP32D signatures of selection are in tight linkage disequilibrium (LD).

AA Sequence

MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANLPKLNKLKKLE      1 - 70
LSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDLFTCEVTNLNNY              71 - 131
//

Text Mined References (11)

PMID Year Title
26112988 2015 Oncogenic acidic nuclear phosphoproteins ANP32C/D are novel clients of heat shock protein 90.
25225945 2014 Genetic variation in SENP1 and ANP32D as predictors of chronic mountain sickness.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
15895553 2005 The Anp32 family of proteins containing leucine-rich repeats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11678310 2001 Expression of pp32 gene family members in breast cancer.
11360199 2001 Tumor suppression and potentiation by manipulation of pp32 expression.
10471270 1999 Correction to "Modulation of oncogenic potential by alternative gene use in human prostate cancer"
10400610 1999 Identification of sequences required for inhibition of oncogene-mediated transformation by pp32.
More...