Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.67
PubTator Score 5.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Degenerative polyarthritis 93
Disease Target Count P-value
non-small cell lung cancer 2798 5.52191652796059E-17
malignant mesothelioma 3163 6.54447040793269E-8
pituitary cancer 1972 1.72422888014269E-7
posterior fossa group B ependymoma 1530 3.42593150590906E-6
osteosarcoma 7933 0.00142991051809158
group 3 medulloblastoma 2254 0.00178037920944926
psoriasis 6685 0.00224603734455522
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0166849077684291
colon cancer 1475 0.0167725381418418
Disease Target Count Z-score Confidence
Osteoarthritis 96 0.0 2.0

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
psoriasis -1.100 0.002
osteosarcoma -1.071 0.001
non-small cell lung cancer 1.301 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.017
colon cancer 1.300 0.017
group 3 medulloblastoma 1.200 0.002
posterior fossa group B ependymoma 1.100 0.000
pituitary cancer 1.100 0.000

Synonym

Accession O95620 B4DLX0 Q2NKK1
Symbols DUS4
PP35

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKSDCMQTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAFRTLVRKYSCDLCYTPMIVAADFVKSIKA      1 - 70
RDSEFTTNQGDCPLIVQFAANDARLLSDAARIVCPYANGIDINCGCPQRWAMAEGYGACLINKPELVQDM     71 - 140
VKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMS    141 - 210
IPVIANGDIRSLKEAENVWRITGTDGVMVARGLLANPAMFAGYEETPLKCIWDWVDIALELGTPYMCFHQ    211 - 280
HLMYMMEKITSRQEKRVFNALSSTSAIIDYLTDHYGI                                     281 - 317
//

Text Mined References (8)

PMID Year Title
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.