Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.67
PubTator Score 5.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
psoriasis -1.100 0.002
osteosarcoma -1.071 0.001
non-small cell lung cancer 1.301 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.017
colon cancer 1.300 0.017
group 3 medulloblastoma 1.200 0.002
posterior fossa group B ependymoma 1.100 0.000
pituitary cancer 1.100 0.000

Gene RIF (2)

PMID Text
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKSDCMQTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAFRTLVRKYSCDLCYTPMIVAADFVKSIKA      1 - 70
RDSEFTTNQGDCPLIVQFAANDARLLSDAARIVCPYANGIDINCGCPQRWAMAEGYGACLINKPELVQDM     71 - 140
VKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMS    141 - 210
IPVIANGDIRSLKEAENVWRITGTDGVMVARGLLANPAMFAGYEETPLKCIWDWVDIALELGTPYMCFHQ    211 - 280
HLMYMMEKITSRQEKRVFNALSSTSAIIDYLTDHYGI                                     281 - 317
//

Text Mined References (8)

PMID Year Title
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.