Property Summary

NCBI Gene PubMed Count 27
Grant Count 5
R01 Count 5
Funding $174,317.6
PubMed Score 27.31
PubTator Score 20.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.039
malignant mesothelioma 1.400 0.000
group 4 medulloblastoma 2.000 0.000
lung cancer 2.000 0.000

Synonym

Accession O95619 Q9NQD0
Symbols YAF9
GAS41
NUBI-1
4930573H17Rik
B230215M10Rik

Gene

Gene RIF (11)

PMID Text
26307679 YEATS4 overexpression is associated with drug resistance of ovarian cancer.
24170126 Findings reveal YEATS4 as a candidate oncogene amplified in NSCLC, and a novel mechanism contributing to NSCLC pathogenesis
22619067 GAS41 amplification results in overexpression and associtated with glioblastoma.
22350108 Our data confirm previous genome-wide findings at 12q15 and suggest differential YEATS4 expression could underpin rs7297610-associated HCTZ response variability, which may have future implications for guiding thiazide treatment.
22068108 Gas41 is able to bind both n-Myc and c-Myc proteins, and that the levels of expression of Gas41 and Myc proteins were similar to each other in such brain tumors as neuroblastomas and glioblastomas.
21317290 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability
20618999 The in vivo interaction of GAS41 and endogenous RAP30 and RAP74 was confirmed by co-immunoprecipitation. GAS41 binds to two non-overlapping regions of the C-terminus of RAP30.
18591461 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18214854 Overexpression of YEATS4 is associated with well-differentiated and dedifferentiated liposarcomas
16705155 GAS41 plays a role in repressing the p53 tumor suppressor pathway during the normal cell cycle by a TIP60-independent mechanism.
More...

AA Sequence

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL      1 - 70
HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD     71 - 140
EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC    141 - 210
LKNEIRKLEEDDQAKDI                                                         211 - 227
//

Text Mined References (28)

PMID Year Title
26307679 2015 Transcriptome analysis indicates TFEB1 and YEATS4 as regulatory transcription factors for drug resistance of ovarian cancer.
24170126 2013 YEATS4 is a novel oncogene amplified in non-small cell lung cancer that regulates the p53 pathway.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
22619067 2012 GAS41 amplification results in overexpression of a new spindle pole protein.
22350108 2013 Association of chromosome 12 locus with antihypertensive response to hydrochlorothiazide may involve differential YEATS4 expression.
22068108 2011 Direct interaction of Gas41 and Myc encoded by amplified genes in nervous system tumours.
21317290 2011 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability.
21269460 2011 Initial characterization of the human central proteome.
20618999 2010 The YEATS family member GAS41 interacts with the general transcription factor TFIIF.
18591461 2008 Genomic association analysis suggests chromosome 12 locus influencing antihypertensive response to thiazide diuretic.
More...