Property Summary

NCBI Gene PubMed Count 29
PubMed Score 30.15
PubTator Score 20.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liposarcoma 20 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 5.0e-06
lung cancer 4740 8.8e-05
group 3 medulloblastoma 4104 1.2e-02
Rheumatoid arthritis 1191 3.9e-02

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.800 1.2e-02
lung cancer 2.000 8.8e-05
malignant mesothelioma 1.400 5.0e-06
Rheumatoid arthritis 1.100 3.9e-02

Gene RIF (13)

AA Sequence

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL      1 - 70
HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD     71 - 140
EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC    141 - 210
LKNEIRKLEEDDQAKDI                                                         211 - 227
//

Text Mined References (31)

PMID Year Title