Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.56
PubTator Score 7.22

Knowledge Summary


No data available



  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.073 0.002


Accession O95602 B7Z7T0 D6W5M0 Q0VG05 Q9UEH0 Q9UFT9 RNA polymerase I subunit A1
Symbols A190


  Ortholog (15)

Gene RIF (6)

25913037 Consistent with this observation, we discovered that polr1a mutant zebrafish exhibited cranioskeletal anomalies mimicking the human phenotype. polr1a loss of function led to perturbed ribosome biogenesis and p53-dependent cell death
22586326 SIRT7 knockdown leads to reduced levels of RNA Pol I protein, but not messenger RNA
22106380 findings demonstrate that Bloom's syndrome helicase (BLM)interacts with RPA194; studies suggest that nucleolar BLM modulates rDNA structures in association with RNA polymerase I to facilitate RNA polymerase I-mediated rRNA transcription
21878508 Interference of POLR1A inhibited the synthesis of rRNA and hindered cell cycle progression in cells with inactivated p53, as a consequence of downregulation of the transcription factor E2F-1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12446911 analyzed the kinetics of assembly and elongation of the RNA polymerase I complex on endogenous ribosomal genes in the nuclei of living cells with the use of in vivo microscopy [RPA43]

AA Sequence

LKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR                                 1681 - 1720

Text Mined References (29)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26089203 2015 The Warsaw breakage syndrome-related protein DDX11 is required for ribosomal RNA synthesis and embryonic development.
25913037 2015 Acrofacial Dysostosis, Cincinnati Type, a Mandibulofacial Dysostosis Syndrome with Limb Anomalies, Is Caused by POLR1A Dysfunction.
25416956 2014 A proteome-scale map of the human interactome network.
23782956 CRM1 and its ribosome export adaptor NMD3 localize to the nucleolus and affect rRNA synthesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22586326 2012 Functional proteomics establishes the interaction of SIRT7 with chromatin remodeling complexes and expands its role in regulation of RNA polymerase I transcription.
22106380 2012 BLM helicase facilitates RNA polymerase I-mediated ribosomal RNA transcription.
21878508 2011 Selective inhibition of rRNA transcription downregulates E2F-1: a new p53-independent mechanism linking cell growth to cell proliferation.
21555369 2011 Nuclear ErbB2 enhances translation and cell growth by activating transcription of ribosomal RNA genes.