Property Summary

NCBI Gene PubMed Count 44
Grant Count 17
R01 Count 17
Funding $739,364.18
PubMed Score 48.01
PubTator Score 42.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.100 0.012
osteosarcoma -2.104 0.000
chronic lymphosyte leukemia 1.200 0.004
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.002
tuberculosis and treatment for 3 months 1.200 0.000
lung cancer -1.300 0.002
adult high grade glioma -1.600 0.000
group 3 medulloblastoma -1.400 0.002
nasopharyngeal carcinoma -1.200 0.000
lung carcinoma -1.200 0.000
Breast cancer -1.600 0.000
invasive ductal carcinoma -1.500 0.028
ovarian cancer -2.300 0.000
pituitary cancer 1.200 0.002
head and neck cancer -1.200 0.008

Gene RIF (34)

PMID Text
26995652 Overexpression of KLF8 may contribute to the progression of pancreatic cancer, and downregulation of KLF8 expression by lentivirus-delivered shRNA is a novel therapeutic approach for PC.
26320172 KLF8-induced FHL2 activation is a novel and critical signaling mechanism underlying human colorectal cancer invasion and metastasis.
26235874 MiR-135a inhibits migration and invasion and regulates epithelial-mesenchymal transition-related marker genes by targeting KLF8 in lung cancer cells.
26133391 KLF8 suppression induced cell differentiation and inhibited tumorigenesis in colorectal cancer
26025929 KLF8 and miR141/EGFR have roles in signaling pathway potentially crucial for breast cancer malignancy
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25333643 KLF8 is a novel epithelial to mesenchymal transition regulating transcription factor that involved in the progression of gastric cancer.
25323066 KLF8 plays a crucial role in proliferation and migration of bladder cancer cells
25040744 KLF8 is involved in hypoxia-induced multidrug resistance through inhibiting apoptosis and increasing the drug release rate by directly regulating MDR1 transcription.
24604387 KLF8 knockdown suppresses proliferation and invasion in human osteosarcoma cells.
More...

AA Sequence

MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEP      1 - 70
PEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLT     71 - 140
PGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDG    141 - 210
KNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAG    211 - 280
CSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLS    281 - 350
LHRRRHDTM                                                                 351 - 359
//

Text Mined References (45)

PMID Year Title
26995652 2016 KLF8 knockdown triggered growth inhibition and induced cell phase arrest in human pancreatic cancer cells.
26320172 2015 KLF8 promotes tumorigenesis, invasion and metastasis of colorectal cancer cells by transcriptional activation of FHL2.
26235874 2015 MiR-135a inhibits migration and invasion and regulates EMT-related marker genes by targeting KLF8 in lung cancer cells.
26133391 2015 Suppression of KLF8 induces cell differentiation and sensitizes colorectal cancer to 5-fluorouracil.
26025929 2015 Identification of epidermal growth factor receptor and its inhibitory microRNA141 as novel targets of Krüppel-like factor 8 in breast cancer.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25333643 2014 Krüppel-like factor 8 involved in hypoxia promotes the invasion and metastasis of gastric cancer via epithelial to mesenchymal transition.
25323066 KLF8 is required for bladder cancer cell proliferation and migration.
25040744 2014 Krüppel-like factor 8 contributes to hypoxia-induced MDR in gastric cancer cells.
24604387 2014 KLF8 knockdown suppresses proliferation and invasion in human osteosarcoma cells.
More...