Property Summary

NCBI Gene PubMed Count 45
PubMed Score 51.84
PubTator Score 42.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.600 8.8e-07
astrocytic glioma -1.100 1.2e-02
atypical teratoid / rhabdoid tumor -1.500 4.6e-06
Breast cancer -1.600 1.9e-05
chronic lymphosyte leukemia 1.200 3.7e-03
glioblastoma -1.100 8.7e-06
group 3 medulloblastoma -1.400 1.6e-03
head and neck cancer -1.200 8.3e-03
invasive ductal carcinoma -1.500 2.8e-02
lung cancer -1.300 2.0e-03
lung carcinoma -1.200 1.9e-19
medulloblastoma, large-cell -1.500 3.1e-04
nasopharyngeal carcinoma -1.200 2.3e-08
osteosarcoma -2.104 3.0e-04
ovarian cancer -2.300 5.4e-10
pituitary cancer 1.200 2.1e-03
primitive neuroectodermal tumor -1.100 2.4e-03
tuberculosis 1.100 1.2e-04

Gene RIF (35)

AA Sequence

MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEP      1 - 70
PEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLT     71 - 140
PGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDG    141 - 210
KNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAG    211 - 280
CSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLS    281 - 350
LHRRRHDTM                                                                 351 - 359
//

Text Mined References (46)

PMID Year Title