Property Summary

NCBI Gene PubMed Count 32
Grant Count 4
Funding $324,041.66
PubMed Score 27.01
PubTator Score 28.89

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95573 Q60I92 Q8IUM9
Symbols ACS3
FACL3
PRO2194

Gene

PANTHER Protein Class (1)

Gene RIF (18)

PMID Text
23840832 The prominent expression of ACSL3 in VSMC.
23762027 activation of fatty acid import is linked to the up-regulation of cellular long chain acyl-CoA synthetase activity and identify the long chain acyl-CoA syntheatse3 (Acsl3) as a novel host factor required for polio replication.
23125841 Tandem affinity purification and mass spectrometry analysis identify acyl-CoA synthetase long-chain family member 3 (ACSL3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify acyl-CoA synthetase long-chain family member 3 (ACSL3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify acyl-CoA synthetase long-chain family member 3 (ACSL3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify acyl-CoA synthetase long-chain family member 3 (ACSL3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22357706 role of N-terminal region of acyl-CoA synthetase 3 in its function and localization on lipid droplets
22190034 Tandem affinity purification and mass spectrometry analysis identify acyl-CoA synthetase long-chain family member 3 (ACSL3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21328461 expression of ACSL3 was induced by endoplasmic reticulum stress
20605918 Results suggest that initiation of Golgi export of Lyn involves association of ACSL3 with the Lyn C-lobe, which is exposed to the molecular surface in an open conformation.
More...

AA Sequence

MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPVNSKPDSAYRS      1 - 70
VNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDV     71 - 140
FVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNI    141 - 210
ITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSD    211 - 280
IAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIG    281 - 350
YSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQI    351 - 420
SKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVW    421 - 490
DYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWL    491 - 560
CTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQK    561 - 630
ELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL    631 - 700
KRKELKTHYQADIERMYGRK                                                      701 - 720
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23840832 2013 Palmitic acid induces osteoblastic differentiation in vascular smooth muscle cells through ACSL3 and NF-?B, novel targets of eicosapentaenoic acid.
23762027 2013 Increased long chain acyl-Coa synthetase activity and fatty acid import is linked to membrane synthesis for development of picornavirus replication organelles.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22357706 2012 The N-terminal region of acyl-CoA synthetase 3 is essential for both the localization on lipid droplets and the function in fatty acid uptake.
21498505 2011 Human lysophosphatidylcholine acyltransferases 1 and 2 are located in lipid droplets where they catalyze the formation of phosphatidylcholine.
21328461 2011 ACSL3 and GSK-3? are essential for lipid upregulation induced by endoplasmic reticulum stress in liver cells.
21269460 2011 Initial characterization of the human central proteome.
20605918 2010 The Lyn kinase C-lobe mediates Golgi export of Lyn through conformation-dependent ACSL3 association.
20308079 2010 Long chain acyl-CoA synthetase-3 is a molecular target for peroxisome proliferator-activated receptor delta in HepG2 hepatoma cells.
More...