Property Summary

NCBI Gene PubMed Count 23
PubMed Score 73.36
PubTator Score 36.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Ethylmalonic encephalopathy 12 8.256 4.0
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0
Disease Target Count Z-score Confidence
Diarrhea 253 3.565 1.8
Exostosis 15 3.158 1.6
Disease Target Count
Encephalopathy, Ethylmalonic 1

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.100 1.6e-03
cystic fibrosis 1.006 8.2e-05
intraductal papillary-mucinous carcinoma... 1.500 4.5e-04
intraductal papillary-mucinous neoplasm ... 1.900 1.9e-03
ovarian cancer 1.400 7.0e-05
pituitary cancer -1.100 4.4e-06
psoriasis 2.300 1.0e-04
ulcerative colitis -1.400 3.4e-06

Gene RIF (13)

AA Sequence

MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGL      1 - 70
RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCV     71 - 140
TFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERT    141 - 210
LNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQTPTA                              211 - 254
//

Text Mined References (27)

PMID Year Title