Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (1)

AA Sequence

MHPINVRRDPSIPIYGLRQSILLNTRLQDCYVDSPALTNIWMARTCAKQNINAPAPATTSSWEVVRNPLI      1 - 70
ASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQARKRNFISSKSKQPAGHRRPAG     71 - 140
GIRESKESSKEKKLTVRQDLEDRYAEHVAATQALPQDSGTAAWKGRVLLPETQKRQQLSEDTLTIHGLPT    141 - 210
EGYQALYHAVVEPMLWNPSGTPKRYSLELGKAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVL    211 - 280
KKWPKLKSKK                                                                281 - 290
//

Text Mined References (8)

PMID Year Title