Property Summary

NCBI Gene PubMed Count 20
PubMed Score 20.24
PubTator Score 17.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.000 4.8e-05
astrocytic glioma -2.500 3.6e-03
Astrocytoma, Pilocytic -1.500 1.0e-05
atypical teratoid / rhabdoid tumor -2.500 9.5e-08
ependymoma -2.400 1.1e-02
glioblastoma -1.600 1.3e-06
group 4 medulloblastoma -1.600 1.5e-04
intraductal papillary-mucinous neoplasm ... 1.600 5.5e-03
lung cancer 1.200 1.2e-03
medulloblastoma, large-cell -3.300 1.9e-07
Multiple myeloma 1.507 2.4e-03
non primary Sjogren syndrome sicca 1.100 3.4e-02
oligodendroglioma -2.000 2.0e-02
osteosarcoma -2.930 4.5e-08
pancreatic ductal adenocarcinoma liver m... -2.053 2.7e-03
Pick disease -1.300 1.7e-03
primitive neuroectodermal tumor -1.900 5.6e-04
ulcerative colitis -1.300 3.3e-05

Gene RIF (10)

AA Sequence

MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTA      1 - 70
QSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQELKAKAHK                  71 - 127
//

Text Mined References (23)

PMID Year Title