Property Summary

NCBI Gene PubMed Count 17
Grant Count 8
R01 Count 4
Funding $675,277.8
PubMed Score 18.40
PubTator Score 17.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (7)

PMID Text
26577410 These results reveal a novel post-translational regulation of MPC1 by Sirt3, which is important for its activity and colon cancer cell growth.
25458841 Tumor cells expressing MPC1 and MPC2 display increased mitochondrial pyruvate oxidation, with no changes in cell growth in adherent culture.
23933155 found no significant difference (P > 0.05) in either allele or genotype frequency in the SNPs between patients and controls.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
3022128 characterization of the rat ortholog

AA Sequence

MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTA      1 - 70
QSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQELKAKAHK                  71 - 127
//

Text Mined References (20)

PMID Year Title
26577410 2015 Sirt3 binds to and deacetylates mitochondrial pyruvate carrier 1 to enhance its activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25458841 2014 A role for the mitochondrial pyruvate carrier as a repressor of the Warburg effect and colon cancer cell growth.
23933155 2013 Lack of association between MPC2 variants and schizophrenia in a replication study of Han Chinese.
22628558 2012 A mitochondrial pyruvate carrier required for pyruvate uptake in yeast, Drosophila, and humans.
22037555 2011 Common variants on 8p12 and 1q24.2 confer risk of schizophrenia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
More...