Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.40
PubTator Score 17.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 4.52117314559451E-8
atypical teratoid / rhabdoid tumor 4369 9.5353777666169E-8
medulloblastoma, large-cell 6234 1.89363413496069E-7
medulloblastoma 1524 4.81448259113961E-6
pilocytic astrocytoma 3086 1.65142167353895E-5
glioblastoma 5572 1.6777018308415E-5
ulcerative colitis 2087 3.32181752367818E-5
adult high grade glioma 2148 4.81189830234993E-5
primitive neuroectodermal tumor 3031 5.64867924929326E-4
lung cancer 4473 0.00120111840626298
Pick disease 1893 0.00167026945909536
Multiple myeloma 1328 0.00242109160510948
astrocytic glioma 2241 0.00359553281527019
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00419508434799019
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00546694386868406
ependymoma 2514 0.0113709924830783
oligodendroglioma 2849 0.0198581585208744
non primary Sjogren syndrome sicca 840 0.034361352307484
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 2.0

Expression

  Differential Expression (18)

Synonym

Accession O95563 A8K261 Q3SXR6 Q6FIF3
Symbols BRP44

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26577410 These results reveal a novel post-translational regulation of MPC1 by Sirt3, which is important for its activity and colon cancer cell growth.
25458841 Tumor cells expressing MPC1 and MPC2 display increased mitochondrial pyruvate oxidation, with no changes in cell growth in adherent culture.
23933155 found no significant difference (P > 0.05) in either allele or genotype frequency in the SNPs between patients and controls.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
3022128 characterization of the rat ortholog

AA Sequence

MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTA      1 - 70
QSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQELKAKAHK                  71 - 127
//

Text Mined References (20)

PMID Year Title
26577410 2015 Sirt3 binds to and deacetylates mitochondrial pyruvate carrier 1 to enhance its activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25458841 2014 A role for the mitochondrial pyruvate carrier as a repressor of the Warburg effect and colon cancer cell growth.
23933155 2013 Lack of association between MPC2 variants and schizophrenia in a replication study of Han Chinese.
22628558 2012 A mitochondrial pyruvate carrier required for pyruvate uptake in yeast, Drosophila, and humans.
22037555 2011 Common variants on 8p12 and 1q24.2 confer risk of schizophrenia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
More...