Property Summary

NCBI Gene PubMed Count 30
Grant Count 16
R01 Count 2
Funding $2,656,128.79
PubMed Score 51.31
PubTator Score 47.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.426 0.004
Multiple myeloma 1.510 0.011
medulloblastoma, large-cell -1.800 0.000
juvenile dermatomyositis 1.426 0.000
acute quadriplegic myopathy 1.358 0.000
colon cancer -2.100 0.000
ulcerative colitis -1.500 0.000
breast carcinoma 1.500 0.008
ovarian cancer -2.100 0.000
dermatomyositis 1.500 0.002

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
720702 screening 1243 / 0 / 369033 Epi Absorbance-based biochemical primary high throughput screening assay to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2)
720732 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2)
743263 screening 252 / 0 / 868 Epi Absorbance-based biochemical high throughput confirmation assay to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2)
743297 confirmatory 59 / 0 / 163 Epi Absorbance-based biochemical high throughput dose response assay to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2)

Gene RIF (22)

PMID Text
25201958 Data show that DNA-repair enzyme TDP2 knockdown in HepG2 cells significantly delays the conversion of relaxed circular DNA (RC-DNA) to covalently closed circular (ccc) DNA.
24856239 This article summarizes and compares the biochemistry, functions, and post-translational regulation of TDP1 and TDP2, as well as the relevance of TDP1 and TDP2 as determinants of response to anticancer agents
24808172 Proteolytic degradation of Top2 enables the processing of Top2.DNA and Top2.RNA covalent complexes by TDP2.
24658003 TDP2 protects transcription from abortive topoisomerase activity and is required for normal neural function.
23433115 Mutations in the 5'-tyrosyl-DNA phosphodiesterase activity of TTRAP,in particular TTRAP(E152A), showed decreased inhibitory activity on cell growth.
22908287 VPg unlinkase activity in different mammalian cell lines correlates with their differential expression of TDP2.
22822062 Biochemical characterization of human tyrosyl-DNA phosphodiesterase 2 (TDP2/TTRAP): a Mg(2+)/Mn(2+)-dependent phosphodiesterase specific for the repair of topoisomerase cleavage complexes.
22405347 Magnesium is indispensable for a 5'-tyrosyl DNA phosphodiesterase activity.
22262880 both FOXP2 and KIAA0319/TTRAP/THEM2 genes play an important role in human language development, but probably through different cerebral pathways.
21921940 findings suggest a previously unidentified function for TTRAP and nucleolar cavities in ribosome biogenesis under stress.
More...

AA Sequence

MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESA      1 - 70
LERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYL     71 - 140
ALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLC    141 - 210
VHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNI    211 - 280
VDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD    281 - 350
HWGLLCNLDIIL                                                              351 - 362
//

Text Mined References (36)

PMID Year Title
25201958 2014 Involvement of the host DNA-repair enzyme TDP2 in formation of the covalently closed circular DNA persistence reservoir of hepatitis B viruses.
24856239 2014 Tyrosyl-DNA-phosphodiesterases (TDP1 and TDP2).
24808172 2014 Proteolytic degradation of topoisomerase II (Top2) enables the processing of Top2·DNA and Top2·RNA covalent complexes by tyrosyl-DNA-phosphodiesterase 2 (TDP2).
24658003 2014 TDP2 protects transcription from abortive topoisomerase activity and is required for normal neural function.
23433115 2013 Overexpression of TTRAP inhibits cell growth and induces apoptosis in osteosarcoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22908287 2012 An RNA virus hijacks an incognito function of a DNA repair enzyme.
22822062 2012 Biochemical characterization of human tyrosyl-DNA phosphodiesterase 2 (TDP2/TTRAP): a Mg(2+)/Mn(2+)-dependent phosphodiesterase specific for the repair of topoisomerase cleavage complexes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22659028 2012 Genome-scale analysis of human mRNA 5' coding sequences based on expressed sequence tag (EST) database.
More...