Property Summary

NCBI Gene PubMed Count 22
Grant Count 15
R01 Count 13
Funding $682,721.17
PubMed Score 30.36
PubTator Score 50.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.135 0.025
Multiple myeloma 1.196 0.002
cutaneous lupus erythematosus 1.900 0.003
psoriasis -1.800 0.000
osteosarcoma -3.275 0.000
astrocytoma 1.200 0.006
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.600 0.000
tuberculosis 1.300 0.000
pediatric high grade glioma 1.200 0.000
COPD -1.200 0.001
ovarian cancer 2.700 0.000
axial spondyloarthropathy 1.100 0.036

Gene RIF (5)

PMID Text
26806015 Depletion of wild-type NADK in pancreatic ductal adenocarcinoma cells attenuates cancer cell growth.
26577408 Taken together, this indicates that Ser-188 (and perhaps the other residues) is an important phosphorylation site that can downregulate the NAD kinase activity of this critical enzyme.
21526340 Using purified human NAD kinase, we revealed a sigmoidal kinetic behavior toward ATP and the inhibitory effects of NADPH and NADH
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17855339 NAD kinase levels control the NADPH concentration in human cells

AA Sequence

MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFRRTRSLHGPCP      1 - 70
VTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEK     71 - 140
KVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLG    141 - 210
FLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQY    211 - 280
QVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICP    281 - 350
HSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES    351 - 420
LAQCLHWNVRKKQAHFEEEEEEEEEG                                                421 - 446
//

Text Mined References (27)

PMID Year Title
26806015 2016 Functional annotation of rare gene aberration drivers of pancreatic cancer.
26577408 2015 Significance of Ser-188 in human mitochondrial NAD kinase as determined by phosphomimetic and phosphoresistant amino-acid substitutions.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21526340 2011 NADPH regulates human NAD kinase, a NADP?-biosynthetic enzyme.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...