Property Summary

NCBI Gene PubMed Count 24
PubMed Score 29.79
PubTator Score 50.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.200 6.4e-03
atypical teratoid / rhabdoid tumor 1.400 6.2e-08
axial spondyloarthropathy 1.100 3.6e-02
COPD -1.200 1.2e-03
cutaneous lupus erythematosus 1.300 1.0e-03
glioblastoma 1.500 5.6e-05
medulloblastoma, large-cell 1.600 8.8e-05
Multiple myeloma 1.196 1.9e-03
osteosarcoma -2.638 1.1e-07
ovarian cancer 2.700 1.1e-05
pediatric high grade glioma 1.100 2.8e-05
psoriasis -1.400 1.0e-03
tuberculosis 1.300 6.1e-06
Waldenstrons macroglobulinemia 1.135 2.5e-02

Gene RIF (6)

AA Sequence

MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFRRTRSLHGPCP      1 - 70
VTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEK     71 - 140
KVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLG    141 - 210
FLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQY    211 - 280
QVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICP    281 - 350
HSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES    351 - 420
LAQCLHWNVRKKQAHFEEEEEEEEEG                                                421 - 446
//

Text Mined References (29)

PMID Year Title