Property Summary

NCBI Gene PubMed Count 22
PubMed Score 30.36
PubTator Score 50.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.31629868845433E-10
atypical teratoid / rhabdoid tumor 4369 6.1675102004273E-8
tuberculosis 1563 6.10021269936097E-6
ovarian cancer 8492 1.14581407189814E-5
pediatric high grade glioma 2712 5.3397976290438E-5
psoriasis 6685 5.45413401109731E-5
glioblastoma 5572 5.60274681309892E-5
medulloblastoma, large-cell 6234 8.82390867776099E-5
COPD 116 0.00124178006901733
Multiple myeloma 1328 0.00191790799540796
cutaneous lupus erythematosus 1056 0.00273132774069526
astrocytoma 1493 0.00642650237182136
Waldenstrons macroglobulinemia 765 0.0251885041894396
axial spondyloarthropathy 28 0.0356926509029682

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.135 0.025
Multiple myeloma 1.196 0.002
cutaneous lupus erythematosus 1.900 0.003
psoriasis -1.800 0.000
osteosarcoma -3.275 0.000
astrocytoma 1.200 0.006
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.600 0.000
tuberculosis 1.300 0.000
pediatric high grade glioma 1.200 0.000
COPD -1.200 0.001
ovarian cancer 2.700 0.000
axial spondyloarthropathy 1.100 0.036

Synonym

Accession O95544 A6NNN3 A8K296 B7Z434 F5GXR5 Q5QPS4 Q9H2P2 Q9H931
Symbols dJ283E3.1

Gene

PANTHER Protein Class (3)

PDB

3PFN  

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
26806015 Depletion of wild-type NADK in pancreatic ductal adenocarcinoma cells attenuates cancer cell growth.
26577408 Taken together, this indicates that Ser-188 (and perhaps the other residues) is an important phosphorylation site that can downregulate the NAD kinase activity of this critical enzyme.
21526340 Using purified human NAD kinase, we revealed a sigmoidal kinetic behavior toward ATP and the inhibitory effects of NADPH and NADH
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17855339 NAD kinase levels control the NADPH concentration in human cells

AA Sequence

MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFRRTRSLHGPCP      1 - 70
VTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEK     71 - 140
KVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLG    141 - 210
FLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQY    211 - 280
QVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICP    281 - 350
HSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES    351 - 420
LAQCLHWNVRKKQAHFEEEEEEEEEG                                                421 - 446
//

Text Mined References (27)

PMID Year Title
26806015 2016 Functional annotation of rare gene aberration drivers of pancreatic cancer.
26577408 2015 Significance of Ser-188 in human mitochondrial NAD kinase as determined by phosphomimetic and phosphoresistant amino-acid substitutions.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21526340 2011 NADPH regulates human NAD kinase, a NADP?-biosynthetic enzyme.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...