Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.78
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.500 0.016
ependymoma -1.700 0.023
oligodendroglioma -1.400 0.028
psoriasis -2.900 0.000
osteosarcoma -2.567 0.000
glioblastoma -1.800 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.800 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.001
colon cancer -1.200 0.002
lung cancer -1.100 0.000
pediatric high grade glioma -1.400 0.000
non-inflammatory breast cancer -1.200 0.018
ovarian cancer -1.500 0.000

Gene RIF (1)

PMID Text
26343356 Data show that polycomb-group proteins BMI1, PHC3, CBX6 and CBX7 expression was significantly increased during imatinib treatment.

AA Sequence

MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPK      1 - 70
KRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQ     71 - 140
GGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIG    141 - 210
KSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPS    211 - 280
PTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGAS    281 - 350
SEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK            351 - 412
//

Text Mined References (13)

PMID Year Title
26343356 2015 Polycomb genes are associated with response to imatinib in chronic myeloid leukemia.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21047797 2011 Recognition and specificity determinants of the human cbx chromodomains.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20601937 2010 Ubiquitin-specific proteases 7 and 11 modulate Polycomb regulation of the INK4a tumour suppressor.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
More...