Property Summary

Ligand Count 5
NCBI Gene PubMed Count 15
PubMed Score 5.29
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 2.6e-05
astrocytic glioma -1.500 1.6e-02
atypical teratoid / rhabdoid tumor -1.100 2.5e-04
colon cancer -1.200 1.5e-03
ependymoma -1.700 2.3e-02
glioblastoma -1.400 9.8e-09
group 3 medulloblastoma -1.700 1.6e-04
intraductal papillary-mucinous adenoma (... -1.200 2.9e-04
intraductal papillary-mucinous carcinoma... -1.300 7.7e-04
lung cancer -1.100 2.6e-04
medulloblastoma, large-cell -1.500 2.5e-05
non-inflammatory breast cancer -1.200 1.8e-02
oligodendroglioma -1.400 2.8e-02
osteosarcoma 1.289 2.6e-03
ovarian cancer -1.500 1.1e-08
primitive neuroectodermal tumor -1.300 1.2e-03
psoriasis 1.100 4.4e-03

Gene RIF (3)

AA Sequence

MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPK      1 - 70
KRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQ     71 - 140
GGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIG    141 - 210
KSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPS    211 - 280
PTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGAS    281 - 350
SEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK            351 - 412
//

Text Mined References (18)

PMID Year Title