Property Summary

NCBI Gene PubMed Count 36
PubMed Score 36.17
PubTator Score 31.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

AA Sequence

MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSL      1 - 70
LALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAILGGTLFILAGLLCMVAVSWTT     71 - 140
NDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYQAPPRATTTTANTAPA    141 - 210
YQPPAAYKDNRAPSVTSATHSGYRLNDYV                                             211 - 239
//

Text Mined References (35)

PMID Year Title