Property Summary

NCBI Gene PubMed Count 18
Grant Count 18
R01 Count 18
Funding $1,925,675.2
PubMed Score 32.17
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 1.200 0.000
urothelial carcinoma -1.100 0.002
uncontrolled asthma -1.100 0.022
osteosarcoma -2.705 0.012
tuberculosis 1.600 0.000
non-small cell lung cancer -1.669 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.029
lung cancer -3.700 0.000
interstitial cystitis 1.800 0.009
primary Sjogren syndrome 1.400 0.002
lung adenocarcinoma -1.900 0.000
lung carcinoma -2.700 0.000
mucosa-associated lymphoid tissue lympho... 1.592 0.008
ulcerative colitis 2.500 0.000
ovarian cancer -1.200 0.000

Gene RIF (7)

PMID Text
25465114 GPI-80 defines a subpopulation of human fetal liver hematopoietic stem/progenitor cells (HSPCs) with self-renewal ability.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17543284 analysis of structural divergence of GPI-80 in activated human neutrophils
14748512 some of the GPI-80 on pseudopodia of migrating neutrophils during the late phase was associated with urokinase-type plasminogen activator receptor (uPAR), a regulator of beta2 integrin-dependent adherence and migration
12967480 elevated GPI-80 expression is associated with development and progression of thymoma
12777063 GPI-80 positive monocytes belong to a monocyte subpopulation that is superior in phagocytosis and reactive oxygen production, but inferior in antigen presentation
12749849 DMSO induces neutrophil differentiation and provides suitable conditions for GPI-80 expression; this culture system is a model for the regulation of GPI-80 expression during myeloid differentiation.

AA Sequence

MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAE      1 - 70
QGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANL     71 - 140
GDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFT    141 - 210
CFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIY    211 - 280
APNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTE    281 - 350
LFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVE    351 - 420
TASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLY    421 - 490
SSCGTSNSAITYLLIFILLMIIALQNIVML                                            491 - 520
//

Text Mined References (20)

PMID Year Title
25465114 2015 GPI-80 defines self-renewal ability in hematopoietic stem cells during human development.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
19322213 2009 Expression of the vanin gene family in normal and inflamed human skin: induction by proinflammatory cytokines.
18805469 2008 Alternative spliced variants in the pantetheinase family of genes expressed in human neutrophils.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
17543284 2007 Structural divergence of GPI-80 in activated human neutrophils.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14748512 2003 GPI-80, a beta2 integrin associated glycosylphosphatidylinositol-anchored protein, concentrates on pseudopodia without association with beta2 integrin during neutrophil migration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...