Property Summary

NCBI Gene PubMed Count 19
PubMed Score 34.57
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 1.200 4.8e-14
interstitial cystitis 1.800 8.6e-03
intraductal papillary-mucinous adenoma (... -1.200 2.9e-02
lung adenocarcinoma -1.900 9.0e-10
lung cancer -1.200 2.7e-02
lung carcinoma -2.700 1.9e-15
mucosa-associated lymphoid tissue lympho... 1.592 8.0e-03
non-small cell lung cancer -1.669 2.7e-11
osteosarcoma -2.705 1.2e-02
ovarian cancer -1.200 6.3e-05
primary Sjogren syndrome 1.400 2.4e-03
tuberculosis 1.600 2.6e-05
ulcerative colitis 2.500 1.3e-05
uncontrolled asthma -1.100 2.2e-02
urothelial carcinoma -1.100 2.2e-03

Gene RIF (8)

AA Sequence

MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAE      1 - 70
QGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANL     71 - 140
GDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFT    141 - 210
CFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIY    211 - 280
APNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTE    281 - 350
LFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVE    351 - 420
TASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLY    421 - 490
SSCGTSNSAITYLLIFILLMIIALQNIVML                                            491 - 520
//

Text Mined References (21)

PMID Year Title