Property Summary

NCBI Gene PubMed Count 39
PubMed Score 53.74
PubTator Score 35.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 1.400 6.5e-05
active Crohn's disease 4.127 6.5e-03
active ulcerative colitis 2.236 3.2e-04
esophageal adenocarcinoma 2.800 3.1e-02
interstitial cystitis 1.900 1.3e-02
intraductal papillary-mucinous neoplasm ... 3.000 1.9e-03
lung carcinoma -1.400 3.0e-07
malignant mesothelioma -5.600 3.5e-08
nephrosclerosis -1.700 2.9e-02
osteosarcoma -2.225 1.8e-03
ovarian cancer -1.500 1.0e-03
pancreatic cancer 1.600 1.7e-02
tuberculosis and treatment for 6 months -2.100 1.5e-02

 IMPC Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (25)

AA Sequence

MTTQLPAYVAILLFYVSRASCQDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDILEGAITSAADQ      1 - 70
GAHIIVTPEDAIYGWNFNRDSLYPYLEDIPDPEVNWIPCNNRNRFGQTPVQERLSCLAKNNSIYVVANIG     71 - 140
DKKPCDTSDPQCPPDGRYQYNTDVVFDSQGKLVARYHKQNLFMGENQFNVPKEPEIVTFNTTFGSFGIFT    141 - 210
CFDILFHDPAVTLVKDFHVDTIVFPTAWMNVLPHLSAVEFHSAWAMGMRVNFLASNIHYPSKKMTGSGIY    211 - 280
APNSSRAFHYDMKTEEGKLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGV    281 - 350
AGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETAST    351 - 420
RFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASS    421 - 490
GLTAQARIIMLIVIAPIVCSLSW                                                   491 - 513
//

Text Mined References (40)

PMID Year Title