Property Summary

NCBI Gene PubMed Count 36
Grant Count 16
R01 Count 16
Funding $1,648,475.2
PubMed Score 48.53
PubTator Score 35.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 2.700 0.000
nephrosclerosis -1.700 0.029
malignant mesothelioma -5.600 0.000
esophageal adenocarcinoma 2.800 0.031
osteosarcoma -3.191 0.001
tuberculosis and treatment for 6 months -2.100 0.015
intraductal papillary-mucinous neoplasm ... 4.700 0.007
active Crohn's disease 4.127 0.006
active ulcerative colitis 7.274 0.000
pancreatic cancer 1.600 0.017
interstitial cystitis 1.900 0.013
lung carcinoma -1.400 0.000
ovarian cancer -1.500 0.001

Gene RIF (22)

PMID Text
26343328 serum pantetheinas, encoded by the VNN1 gene, level regulates erythrocyte life span and modulates the risk of developing complicated malaria.
25910714 VNN1 contributes to corticosteroid responsiveness, and changes in VNN1 nasal epithelial mRNA expression and VNN1 promoter methylation might be clinically useful biomarkers of treatment response in asthmatic children.
25478849 The X-ray crystal structure of human vanin 1 at 2.25 A resolution is presented, which is the first reported structure from the vanin family, as well as a crystal structure of vanin 1 bound to a specific inhibitor.
25233454 Our study provides strong biological evidence for the association of the identified SNP with BP and suggests that vanin-1 misfolding and degradation are the underlying molecular mechanism.
24751833 show that hepatic vanin-1 is under extremely sensitive regulation by PPARalpha and that plasma vanin activity could serve as a readout of changes in PPARalpha activity in human subjects
24702142 Serum vanin-1 levels may be low in the end-stage renal failure and transiently increase after transplant owing to transient renal function deterioration, which does not lead to elevation of serum creatinine levels in renal transplant patients.
24687856 Alternative Splicing in VNN1 gene is associated with colorectal cancer.
24140347 Liver contributes to Vanin-1 secretion in serum and PPARalpha is a limiting factor in serum Vnn1 production.
24106341 Microparticle internalization required the interaction of the ectoenzyme Vanin-1 (VNN1), an abundant surface protein on the microparticles, with lipid raft domains of endothelial cells.
23978960 It isthe enzyme that recycles pantothenic acid (vitamin B5) generated during coenzyme A breakdown and actively involved in the progression of inflammatory reactions by generating cysteamine.
More...

AA Sequence

MTTQLPAYVAILLFYVSRASCQDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDILEGAITSAADQ      1 - 70
GAHIIVTPEDAIYGWNFNRDSLYPYLEDIPDPEVNWIPCNNRNRFGQTPVQERLSCLAKNNSIYVVANIG     71 - 140
DKKPCDTSDPQCPPDGRYQYNTDVVFDSQGKLVARYHKQNLFMGENQFNVPKEPEIVTFNTTFGSFGIFT    141 - 210
CFDILFHDPAVTLVKDFHVDTIVFPTAWMNVLPHLSAVEFHSAWAMGMRVNFLASNIHYPSKKMTGSGIY    211 - 280
APNSSRAFHYDMKTEEGKLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGV    281 - 350
AGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETAST    351 - 420
RFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASS    421 - 490
GLTAQARIIMLIVIAPIVCSLSW                                                   491 - 513
//

Text Mined References (37)

PMID Year Title
26343328 2015 Serum pantetheinase/vanin levels regulate erythrocyte homeostasis and severity of malaria.
25910714 2015 Vanin-1 expression and methylation discriminate pediatric asthma corticosteroid treatment response.
25478849 2014 The structure of vanin 1: a key enzyme linking metabolic disease and inflammation.
25233454 2014 The association of the vanin-1 N131S variant with blood pressure is mediated by endoplasmic reticulum-associated degradation and loss of function.
24751833 2014 PPAR-alpha dependent regulation of vanin-1 mediates hepatic lipid metabolism.
24702142 2014 Serum vanin-1 levels in renal transplant patients.
24687856 2014 A novel transcript, VNN1-AB, as a biomarker for colorectal cancer.
24140347 2013 PPARalpha regulates the production of serum Vanin-1 by liver.
24106341 2013 Lipid-induced toxicity stimulates hepatocytes to release angiogenic microparticles that require Vanin-1 for uptake by endothelial cells.
23978960 2013 Linkage between coenzyme a metabolism and inflammation: roles of pantetheinase.
More...