Property Summary

NCBI Gene PubMed Count 25
Grant Count 2
Funding $416,103.67
PubMed Score 6.84
PubTator Score 8.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Prostatic Neoplasms 471
pituitary cancer 1,972

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.100 0.001

Gene RIF (10)

PMID Text
26464708 the expression of claudin-5 and claudin-9 was down-regulated while the expression of claudin-8 was up-regulated in cervical carcinoma tissues compared with adjacent non-neoplastic tissues.
25281028 CLDN9 may be an important biomarker for invasive pituitary oncocytomas.
23864633 Although claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not dependent on claudin-6 and claudin-9.
20874001 Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line.
19960275 Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19696885 Mouse studies suggest that claudin-9 deficiency may cause hearing loss not only in mice but also in humans.
18234789 claudin-6 and claudin-9 expressed in CD81+ cells also enable the entry of HCV pseudoparticles derived from six of the major genotypes.
17804490 Residues N38 and V45 in the first extracellular loop (EL1) of CLDN9 are necessary for HCV entry.
12736707 CLDN9, clustered with CLDN6 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVILLLAGILVLIPVCWTA     71 - 140
HAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASG    141 - 210
LDKRDYV                                                                   211 - 217
//

Text Mined References (25)

PMID Year Title
26464708 2015 Expression of claudin-5, -7, -8 and -9 in cervical carcinoma tissues and adjacent non-neoplastic tissues.
25281028 2014 Overexpression of the cell adhesion molecule claudin-9 is associated with invasion in pituitary oncocytomas.
23864633 2013 Functional analysis of claudin-6 and claudin-9 as entry factors for hepatitis C virus infection of human hepatocytes by using monoclonal antibodies.
20874001 2011 Claudin-6, 7, or 9 overexpression in the human gastric adenocarcinoma cell line AGS increases its invasiveness, migration, and proliferation rate.
19960275 2010 Distribution and expression pattern of claudins 6, 7, and 9 in diffuse- and intestinal-type gastric adenocarcinomas.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19706201 2009 The claudins.
19696885 2009 A claudin-9-based ion permeability barrier is essential for hearing.
18234789 2008 The tight junction proteins claudin-1, -6, and -9 are entry cofactors for hepatitis C virus.
18036336 2008 Structure and function of claudins.
More...