Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.74
PubTator Score 7.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.197 0.002
Multiple myeloma 1.614 0.001
sonic hedgehog group medulloblastoma 1.300 0.000
ovarian cancer -2.300 0.000

Synonym

Accession O95478
Symbols HCLG1
TINP1
CDK105
HCL-G1
HUSSY29
HUSSY-29

Gene

 GO Function (1)

Gene RIF (6)

PMID Text
23912275 TINP1 promotes cell proliferation and significantly reduces p53 and p21 expression.
23220173 NSA2, which increases in diabetic nephropathy, may be involved in the actions of TGFbeta1 and contribute to the development of diabetic nephropathy.
22095236 Data suggest that circulating NSA2 is elevated in diabetic nephropathy patients with albuminuria, and that renal and circulating NSA2 levels are increased in hyperglycemia in experimental models of diabetes.
19932687 these results demonstrated that NSA2 is a nucleolar protein involved in cell proliferation and cell cycle regulation.
19460752 Knockdown of NSA2 ribosome biogenesis homolog (S. cerevisiae, NSA2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16861225 The yeast ortholog, Nsa2, is a pre-ribosomal factor that is essential for biogenesis of the large ribosomal subunit.

AA Sequence

MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQMKKTIKMHEK      1 - 70
RNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGK     71 - 140
RKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTT    141 - 210
LGVITKGTVIEVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV                        211 - 260
//

Text Mined References (16)

PMID Year Title
23912275 2013 A novel human TINP1 gene promotes cell proliferation through inhibition of p53 and p21 expression.
23220173 2013 Nop-7-associated 2 (NSA2), a candidate gene for diabetic nephropathy, is involved in the TGF?1 pathway.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22095236 2012 Elevated levels of renal and circulating Nop-7-associated 2 (NSA2) in rat and mouse models of diabetes, in mesangial cells in vitro and in patients with diabetic nephropathy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19932687 2010 NSA2, a novel nucleolus protein regulates cell proliferation and cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16861225 2006 Nsa2 is an unstable, conserved factor required for the maturation of 27 SB pre-rRNAs.
More...