Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.30
PubTator Score 7.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Biliary 33 0.0 0.0
Disease Target Count
Biliary cirrhosis 45
Disease Target Count P-value
ovarian cancer 8520 1.9e-08
group 3 medulloblastoma 4104 8.2e-04
Multiple myeloma 1332 1.1e-03
Waldenstrons macroglobulinemia 765 2.2e-03

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 8.2e-04
Multiple myeloma 1.614 1.1e-03
ovarian cancer -2.300 1.9e-08
Waldenstrons macroglobulinemia 1.197 2.2e-03

 GO Function (1)

Gene RIF (6)

AA Sequence

MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQMKKTIKMHEK      1 - 70
RNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGK     71 - 140
RKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTT    141 - 210
LGVITKGTVIEVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV                        211 - 260
//

Text Mined References (17)

PMID Year Title