Property Summary

Ligand Count 1
NCBI Gene PubMed Count 651
PubMed Score 1451.76
PubTator Score 1223.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Hypercholesterolemia 44
Hyperlipidemia 43
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 1.0
Liver cancer 604 0.0 0.6

Expression

  Differential Expression (34)

Disease log2 FC p
diabetes mellitus -1.200 1.2e-02
active ulcerative colitis -1.879 2.1e-02
acute quadriplegic myopathy 1.868 1.4e-06
adrenocortical carcinoma -1.955 6.5e-04
adult high grade glioma 1.800 4.5e-04
astrocytic glioma 2.000 4.2e-02
Astrocytoma, Pilocytic 2.100 3.8e-07
atypical teratoid / rhabdoid tumor 2.200 8.1e-06
autosomal dominant Emery-Dreifuss muscul... 1.216 2.6e-03
colon cancer -1.600 1.3e-02
cystic fibrosis 1.100 1.2e-03
dermatomyositis 1.100 4.2e-04
Down syndrome 1.700 3.2e-04
ductal carcinoma in situ -1.200 5.3e-03
ependymoma 2.500 4.7e-02
facioscapulohumeral dystrophy -1.400 4.5e-02
glioblastoma 2.000 1.4e-07
group 3 medulloblastoma 1.300 3.5e-02
invasive ductal carcinoma -1.100 2.0e-02
juvenile dermatomyositis 1.147 5.0e-08
lung cancer -1.400 4.9e-03
lung carcinoma -2.100 5.5e-24
malignant mesothelioma -6.900 2.3e-10
oligodendroglioma 1.700 4.6e-02
osteosarcoma 1.147 1.1e-03
ovarian cancer 1.300 1.6e-03
pancreatic ductal adenocarcinoma liver m... -2.516 9.9e-04
Pick disease 1.200 1.4e-02
primary Sjogren syndrome 1.200 3.6e-03
progressive supranuclear palsy -1.200 3.5e-02
pterygium 1.100 1.3e-02
sarcoidosis 1.300 1.3e-02
subependymal giant cell astrocytoma 3.536 6.4e-03
tuberculosis -2.900 4.6e-05

Gene RIF (637)

AA Sequence

MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWV      1 - 70
QGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSS     71 - 140
NLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQE    141 - 210
VSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSD    211 - 280
MRQEVMFLTNVNSSSSSTQIYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNS    281 - 350
TTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELS    351 - 420
PKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNGSVYTWREAFNE    421 - 490
TNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTGITPGSIELPHHVKYKIRMDI    491 - 560
DNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEKKTGVYMQQMPYPCYVDD    561 - 630
IFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLL    631 - 700
VVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDY    701 - 770
VGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTW    771 - 840
YIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHPGSNQKRISEICMEEEPTHLKLGVSIQNLVKVYRD    841 - 910
GMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQ    911 - 980
HNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGG    981 - 1050
SKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKN   1051 - 1120
QLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKH   1121 - 1190
VSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAE   1191 - 1260
TSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFV   1261 - 1330
ALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTG   1331 - 1400
TLELLNALTKDPGFGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKI   1401 - 1470
KKMLPVCPPGAGGLPPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVS   1471 - 1540
NTQALPPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNVKVWFNNKGWHAISSFLNVIN   1541 - 1610
NAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQER   1611 - 1680
VSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSIT   1681 - 1750
PLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDNKLNNINDILKSVFLIFPHFCLGRGLI   1751 - 1820
DMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPLND   1821 - 1890
EDEDVRRERQRILDGGGQNDILEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLT   1891 - 1960
GDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIR   1961 - 2030
KLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLT   2031 - 2100
SHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGLAFPGSVLKE   2101 - 2170
KHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDHLKDLSLHKNQT   2171 - 2240
VVDVAVLTSFLQDEKVKESYV                                                    2241 - 2261
//

Text Mined References (661)

PMID Year Title