Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 5.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 2.1e-02
Disease Target Count Z-score Confidence
Lipodystrophy 40 3.102 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 2.1e-02

Gene RIF (3)

AA Sequence

MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDE      1 - 70
TLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSA     71 - 140
VADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPS    141 - 210
DTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW                                        211 - 244
//

Text Mined References (13)

PMID Year Title