Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $415,423.66
PubMed Score 0.00
PubTator Score 5.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 2.200 0.003

Synonym

Accession O95476 D3DTN7 Q96GQ9
Symbols NET56
DULLARD
HSA011916

Gene

Gene RIF (2)

PMID Text
21413788 dullard shows specificity for the peptide corresponding to the insulin-dependent phosphorylation site (Ser106) of lipin
17420445 Dullard participates in a unique phosphatase cascade regulating nuclear membrane biogenesis, a cascade that is conserved from yeast to mammals.

AA Sequence

MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDE      1 - 70
TLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSA     71 - 140
VADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPS    141 - 210
DTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW                                        211 - 244
//

Text Mined References (12)

PMID Year Title
25944354 2015 Host interactions of Chandipura virus matrix protein.
22134922 2012 Nuclear envelope phosphatase 1-regulatory subunit 1 (formerly TMEM188) is the metazoan Spo7p ortholog and functions in the lipin activation pathway.
21413788 2011 Homo sapiens dullard protein phosphatase shows a preference for the insulin-dependent phosphorylation site of lipin1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17420445 2007 A conserved phosphatase cascade that regulates nuclear membrane biogenesis.
17157258 2006 Determinants for dephosphorylation of the RNA polymerase II C-terminal domain by Scp1.
17141153 2006 Dullard promotes degradation and dephosphorylation of BMP receptors and is required for neural induction.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...