Property Summary

NCBI Gene PubMed Count 93
PubMed Score 108.88
PubTator Score 98.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ductal carcinoma in situ 1.600 1.8e-03
gastric carcinoma 2.900 2.6e-02
interstitial cystitis -1.800 2.6e-03
intraductal papillary-mucinous carcinoma... 1.400 1.1e-04
invasive ductal carcinoma 1.800 5.0e-03
lung adenocarcinoma 1.127 2.7e-04
nasopharyngeal carcinoma -1.100 5.1e-06
osteosarcoma 2.022 1.0e-06
ovarian cancer 1.200 7.2e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (71)

AA Sequence

MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSV      1 - 70
LALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWY     71 - 140
GHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEY    141 - 210
V//

Text Mined References (95)

PMID Year Title