Property Summary

NCBI Gene PubMed Count 86
Grant Count 121
R01 Count 66
Funding $13,962,562.92
PubMed Score 102.29
PubTator Score 98.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.022 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.000
interstitial cystitis -1.800 0.003
nasopharyngeal carcinoma -1.100 0.000
lung adenocarcinoma 1.127 0.000
gastric carcinoma 2.900 0.026
ductal carcinoma in situ 1.600 0.002
invasive ductal carcinoma 1.800 0.005
ovarian cancer 1.200 0.000

Synonym

Accession O95471 B2R9X7 D3DTP0 Q6IPN3 Q7Z4Y7 Q9BVN0 CLDN-7
Symbols CLDN-7
CEPTRL2
CPETRL2
Hs.84359
claudin-1

Gene

PANTHER Protein Class (2)

Gene RIF (65)

PMID Text
26464708 The expression of claudin-7 has no obviously difference between cervical carcinoma tissues and adjacent non-neoplastic tissues.
26340953 localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua
26319240 claudin 1 and claudin 4 are differentially involved in atopic dermatitis pathogenesis
26216285 We identified hepatocyte nuclear factor 4alpha as a regulatory factor that bound endogenous CLDN7 promoter in differentiating intestinal epithelial cells and stimulated CLDN7 promoter activity.
26081244 we identified a previously unrecognized function of claudin-7 in regulating cell proliferation and maintaining epithelial cell attachment through engaging integrin beta1.
26054340 CLDN-7 palmitoylation prohibits tight junction integration and fosters glycolipid-enriched membrane domains recruitment. Via associated molecules, palmitoylated CLDN-7supports motility and invasion.
25778318 Icreased claudin 7 expression was related to decreased survival in nasopharyngeal carcinoma.
25759378 A variant, rs222857, in the CLDN7 locus, predicted adiponectin increases within intensive lifestyle intervention.
25514462 Data indicate that claudin-7 knockdown cells display decreased anchorage-independent growth.
25500541 Loss of claudin-7 potentiates epithelial-to-mesenchymal transition to promote colon cancer, in a manner dependent on Rab25.
More...

AA Sequence

MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSV      1 - 70
LALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWY     71 - 140
GHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEY    141 - 210
V//

Text Mined References (88)

PMID Year Title
26464708 2015 Expression of claudin-5, -7, -8 and -9 in cervical carcinoma tissues and adjacent non-neoplastic tissues.
26340953 2015 Claudin-3, claudin-7, and claudin-10 show different distribution patterns during decidualization and trophoblast invasion in mouse and human.
26319240 2015 Diverse regulation of claudin-1 and claudin-4 in atopic dermatitis.
26216285 2015 HNF4? regulates claudin-7 protein expression during intestinal epithelial differentiation.
26081244 2015 A non-tight junction function of claudin-7-Interaction with integrin signaling in suppressing lung cancer cell proliferation and detachment.
26054340 2015 The importance of claudin-7 palmitoylation on membrane subdomain localization and metastasis-promoting activities.
25778318 Expression patterns of claudins 1, 4, and 7 and their prognostic significance in nasopharyngeal carcinoma.
25759378 2015 A common variant in the CLDN7/ELP5 locus predicts adiponectin change with lifestyle intervention and improved fitness in obese individuals with diabetes.
25514462 2015 Claudin-7 promotes the epithelial-mesenchymal transition in human colorectal cancer.
25500541 2015 Claudin-7 expression induces mesenchymal to epithelial transformation (MET) to inhibit colon tumorigenesis.
More...