Property Summary

NCBI Gene PubMed Count 438
PubMed Score 1389.74
PubTator Score 1344.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
substance-related disorder 162 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 4.074 2.0
Cushing's syndrome 48 3.595 1.8
Obesity 678 3.531 1.8

Synonym

Accession O95467 B2RB88 E1P5G2 O95417 NESP55
Symbols AHO
GSA
GSP
POH
GPSA
NESP
SCG6
SgVI
GNAS1
PITA3
C20orf45

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (351)

AA Sequence

MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHR      1 - 70
SGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETE     71 - 140
PEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEP    141 - 210
KEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH                                       211 - 245
//

Text Mined References (441)

PMID Year Title