Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.03
PubTator Score 19.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.56115102818596E-21
malignant mesothelioma 3163 6.05308201435497E-8
osteosarcoma 7933 4.01245335209619E-5
cutaneous lupus erythematosus 1056 0.003643478015256
Rheumatoid Arthritis 1171 0.0328647729727606
acute myeloid leukemia 785 0.033253651721168
Disease Target Count Z-score Confidence
Chondrosarcoma 24 3.612 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.033
malignant mesothelioma 2.400 0.000
cutaneous lupus erythematosus 1.500 0.004
osteosarcoma -2.031 0.000
lung carcinoma -1.300 0.000
acute myeloid leukemia 1.300 0.033

Synonym

Accession O95466 D2DGW2 Q6DKG5 Q6IBP3 Q86UH1 Q8N671 Q8TDH1 Q96H10
Symbols FMNL
FHOD4
KW-13
C17orf1
C17orf1B

Gene

PDB

4YDH  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (7)

PMID Text
23801653 FMNL1 contributes to leukemogenesis and could act in part through Rac1 regulation.
23460512 Results suggest that macrophage coiling phagocytosis is a complex process involving several actin nucleation/regulatory factors. They also point specifically to the formins mDia1 and FMNL1 as novel regulators of spirochete uptake by human immune cells.
23182705 constitutively activated form of FMNL1 (FMNL1gamma) induces localization of AHNAK1 to the cell membrane.
21148482 after Rac-dependent activation of FMNL1, srGAP2 mediates a potent mechanism to limit the duration of Rac action and inhibit formin activity during rapid actin dynamics.
20617518 Our data suggest that FRL1 is responsible for modifying actin at the macrophage podosome and may be involved in actin cytoskeleton dynamics during adhesion and migration within tissues.
19815554 Results describe N-myristoylation as a regulative mechanism of FMNL1 responsible for membrane trafficking potentially involved in a diversity of polarized processes of hematopoietic lineage-derived cells.
14592423 Western blot analysis demonstrated that the protein encoded by this gene is overexpressed in lymphoid malignancies, cancer cell lines and peripheral blood leukocyte from chronic lymphocytic leukemia (CLL) patients.

AA Sequence

MGNAAGSAEQPAGPAAPPPKQPAPPKQPMPAAGELEERFNRALNCMNLPPDKVQLLSQYDNEKKWELICD      1 - 70
QERFQVKNPPAAYIQKLKSYVDTGGVSRKVAADWMSNLGFKRRVQESTQVLRELETSLRTNHIGWVQEFL     71 - 140
NEENRGLDVLLEYLAFAQCSVTYDMESTDNGASNSEKNKPLEQSVEDLSKGPPSSVPKSRHLTIKLTPAH    141 - 210
SRKALRNSRIVSQKDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEIALSLNNKNPRTKALVLELLAAVC    211 - 280
LVRGGHDIILAAFDNFKEVCGEQHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVENMNFRVFLQYEF    281 - 350
THLGLDLYLERLRLTESDKLQVQIQAYLDNIFDVGALLEDTETKNAVLEHMEELQEQVALLTERLRDAEN    351 - 420
ESMAKIAELEKQLSQARKELETLRERFSESTAMGPSRRPPEPEKAPPAAPTRPSALELKVEELEEKGLIR    421 - 490
ILRGPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPS    491 - 560
APPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPDALGRRDSELGPGV    561 - 630
KAKKPIQTKFRMPLLNWVALKPSQITGTVFTELNDEKVLQELDMSDFEEQFKTKSQGPSLDLSALKSKAA    631 - 700
QKAPSKATLIEANRAKNLAITLRKGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLITRFER    701 - 770
EQRPMEELSEEDRFMLCFSRIPRLPERMTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQILEI    771 - 840
VLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSV    841 - 910
SLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKT    911 - 980
TSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMDLISELKRRQ    981 - 1050
QKEPLIYESDRDGAIEDIITVIKTVPFTARTGKRTSRLLCEASLGEEMPL                       1051 - 1100
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23801653 2013 FMNL1 promotes proliferation and migration of leukemia cells.
23460512 2013 The formins FMNL1 and mDia1 regulate coiling phagocytosis of Borrelia burgdorferi by primary human macrophages.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23182705 2013 Proteomic investigation of the interactome of FMNL1 in hematopoietic cells unveils a role in calcium-dependent membrane plasticity.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21269460 2011 Initial characterization of the human central proteome.
More...