Property Summary

NCBI Gene PubMed Count 22
Grant Count 127
R01 Count 97
Funding $11,874,578.47
PubMed Score 8.07
PubTator Score 13.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.300 0.002
medulloblastoma, large-cell 1.900 0.000
pancreatic ductal adenocarcinoma liver m... -1.033 0.013
lung cancer 1.700 0.004
colon cancer 1.100 0.012
ovarian cancer 2.200 0.000

Synonym

Accession O95456 B5BUN2 Q6FHA3 Q6FHD3 Q6S713 PAC-1
Symbols PAC1
DSCR2
PAC-1
C21LRP
LRPC21

Gene

Gene RIF (9)

PMID Text
27100087 RNA-seq evidence of biallelic expression of PSMG1 and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of PSMG1 is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
22593026 PSMG1 mutation is associated with Crohn's disease.
21509594 PSMG1 gene expression is increased in classic variant of papillary thyroid carcinoma.
21079743 Data show that an additive gene-gene interaction involving TLR4, PSMG1, TNFRSF6B and IRGM was identified with CD.
18793612 DSCR2 was found to interact with PPARbeta and to inhibit it.
18758464 Genome-wide association study of gene-disease association. (HuGE Navigator)
16251969 two chaperones, designated proteasome assembling chaperone-1 (PAC1) and PAC2, form a heterodimer and are involved in the maturation of mammalian 20S proteasomes
15670775 Further, the results of intracellular localization studies and membrane fractionation assays indicate that DSCR2 is targeted to a cytoplasmic compartment as a soluble form.
15590417 The DSCR2 protein is associated with the endoplasmic reticulum; it is not an integral membrane protein and it is maintained on the cytoplasmic side of the ER by indirect interaction with the ER membrane or with another protein.

AA Sequence

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSK      1 - 70
FIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCY     71 - 140
VAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPN    141 - 210
IVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTN    211 - 280
EIQSNIYT                                                                  281 - 288
//

Text Mined References (31)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22593026 Pseudomonas infection in children with early-onset Crohn's disease: an association with a mutation close to PSMG1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
More...