Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.14
PubTator Score 13.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer 1.100 1.2e-02
lung cancer 1.700 3.9e-03
medulloblastoma, large-cell 1.900 5.4e-05
ovarian cancer 2.200 3.0e-05
pancreatic ductal adenocarcinoma liver m... -1.033 1.3e-02
psoriasis 1.300 2.2e-03

Gene RIF (9)

AA Sequence

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSK      1 - 70
FIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCY     71 - 140
VAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPN    141 - 210
IVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTN    211 - 280
EIQSNIYT                                                                  281 - 288
//

Text Mined References (31)

PMID Year Title