Property Summary

NCBI Gene PubMed Count 7
PubMed Score 43.77
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Catel Manzke syndrome 2
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 4.10859457215923E-4
group 3 medulloblastoma 2254 0.00111098988484867
ovarian cancer 8492 0.0141183564324742
Disease Target Count Z-score Confidence
Fleck corneal dystrophy 9 3.222 1.6
Disease Target Count
Catel-Manzke syndrome 1

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
group 3 medulloblastoma 1.200 0.001
ovarian cancer 1.100 0.014

Synonym

Accession O95455 Q05DQ3 Q2TU31 Q5T3Z2 Q9H1T9
Symbols TDPGD
SDR2E1
CATMANS

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (2)

PMID Text
25480037 By using haplotype reconstruction we showed that the mutation c.298G>T is probably a founder mutation. Due to the spectrum of the amino acid changes, we suggest that loss of function in TGDS is the underlying mechanism of Catel-Manzke syndrome.
18976975 Knockdown of TDP-glucose 4,6-dehydratase (TGDS) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKNLETISNKQNY      1 - 70
KFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHEARVEKFIYV     71 - 140
STDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKF    141 - 210
ISLLQHNRKCCIHGSGLQTRNFLYATDVVEAFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETN    211 - 280
SESEMENWVDYVNDRPTNDMRYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEKALEPFPV    281 - 350
//

Text Mined References (8)

PMID Year Title
25480037 2014 Homozygous and compound-heterozygous mutations in TGDS cause Catel-Manzke syndrome.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12604213 2003 Coenzyme-based functional assignments of short-chain dehydrogenases/reductases (SDRs).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.