Property Summary

NCBI Gene PubMed Count 7
PubMed Score 43.77
PubTator Score 4.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
group 3 medulloblastoma 1.200 0.001
ovarian cancer 1.100 0.014

Gene RIF (2)

PMID Text
25480037 By using haplotype reconstruction we showed that the mutation c.298G>T is probably a founder mutation. Due to the spectrum of the amino acid changes, we suggest that loss of function in TGDS is the underlying mechanism of Catel-Manzke syndrome.
18976975 Knockdown of TDP-glucose 4,6-dehydratase (TGDS) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKNLETISNKQNY      1 - 70
KFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHEARVEKFIYV     71 - 140
STDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKF    141 - 210
ISLLQHNRKCCIHGSGLQTRNFLYATDVVEAFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETN    211 - 280
SESEMENWVDYVNDRPTNDMRYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEKALEPFPV    281 - 350
//

Text Mined References (8)

PMID Year Title
25480037 2014 Homozygous and compound-heterozygous mutations in TGDS cause Catel-Manzke syndrome.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12604213 2003 Coenzyme-based functional assignments of short-chain dehydrogenases/reductases (SDRs).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.