Property Summary

NCBI Gene PubMed Count 22
Grant Count 123
R01 Count 36
Funding $31,155,324.42
PubMed Score 1364.08
PubTator Score 44.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95450 ADAM-TS 2
Symbols NPI
PNPI
PCINP
PCPNI
PCI-NP
PC I-NP
ADAM-TS2
ADAMTS-2
ADAMTS-3

Gene

Gene RIF (10)

PMID Text
26232334 IL-1a is a strong positive regulator of ADAMTS-2 and ADAMTS-3 expression.
25863161 Data indicate that ADAMTS2 and 3 cleave the amino-propeptide of fibrillar collagens and regulate blood vessels homeostasis and lymphangiogenesis. Also, ADAMTS2 deficiency leads to the dermatosparactic type of Ehlers-Danlos syndrome. [review]
25674217 ADAMTS2 was significantly overexpressed in Fibrous dysplasia (FD) tissues, but rarely expressed in normal bone tissues, suggesting that ADAMTS2 could be a potential biomarker for FD
24752352 Pathway inhibition studies revealed that ADAMTS-2 upregulation by IL-6 was mediated by JNK pathway.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of ADAM metallopeptidase with thrombospondin type 1 motif-2 (ADAMTS2) expression as compared to untreated control
22205175 ADAMTS-2, -3, and -13 expression, but not that of ADAMTS-14, are increased in plaques causing AMI compared those associated with stable angina.
20574651 Data show that ADAMTS-2 is able to reduce proliferation of endothelial cells, and to induce their retraction and detachment from the substrate resulting in apoptosis.
16046392 Determination of the processing, activity and cleavage specificity of the bovine ADAMTS2 protein.
15373769 Although exons 3-5 or 14-16 encode protein domains that have not been recognized as crucial for ADAMTS-2 activity, the aminoprocollagen processing was strongly impaired, providing evidence for the requirement of these domains for proper enzyme function
11788898 when conditioned media of TSP2-transfectants were added to cultures of bovine pulmonary microvascular endothelial cells (BPMEC), the BPMEC proliferation was significantly inhibited; suggesting that human TSP2 is a potential inhibitor of angiogenesis

AA Sequence

MDPPAGAARRLLCPALLLLLLLLPPPLLPPPPPPANARLAAAADPPGGPLGHGAERILAVPVRTDAQGRL      1 - 70
VSHVVSAATSRAGVRARRAAPVRTPSFPGGNEEEPGSHLFYNVTVFGRDLHLRLRPNARLVAPGATMEWQ     71 - 140
GEKGTTRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAGLIRMEEEEFFIEPLEKGLAAQEAEQGRVHV    141 - 210
VYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEVLLGVDDSVVQ    211 - 280
FHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQ    281 - 350
KPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDG    351 - 420
QGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNE    421 - 490
QCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKR    491 - 560
DGSWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCSGLAYDFQLCSRQDCPDSLADFREEQCRQW    561 - 630
DLYFEHGDAQHHWLPHEHRDAKERCHLYCESRETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCD    631 - 700
GVIGSSKQEDKCGVCGGDNSHCKVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHLAVKNLET    701 - 770
GKFILNEENDVDASSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPVGDTRVSLTYKYMIHEDS    771 - 840
LNVDDNNVLEEDSVVYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSKPKAIRRACNP    841 - 910
QECSQPVWVTGEWEPCSQTCGRTGMQVRSVRCIQPLHDNTTRSVHAKHCNDARPESRRACSRELCPGRWR    911 - 980
AGPWSQCSVTCGNGTQERPVLCRTADDSFGICQEERPETARTCRLGPCPRNISDPSKKSYVVQWLSRPDP    981 - 1050
DSPIRKISSKGHCQGDKSIFCRMEVLSRYCSIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFM   1051 - 1120
PTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKT   1121 - 1190
RNQRIQELIDEMRKKEMLGKF                                                    1191 - 1211
//

Text Mined References (23)

PMID Year Title
26232334 2015 Induction of human ADAMTS-2 gene expression by IL-1? is mediated by a multiple crosstalk of MEK/JNK and PI3K pathways in osteoblast like cells.
25863161 The procollagen N-proteinases ADAMTS2, 3 and 14 in pathophysiology.
25674217 2014 Gene expression profiling of craniofacial fibrous dysplasia reveals ADAMTS2 overexpression as a potential marker.
24752352 2014 IL-6 upregulates a disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS-2) in human osteosarcoma cells mediated by JNK pathway.
22990015 2012 A genome-wide association study identifies a gene network of ADAMTS genes in the predisposition to pediatric stroke.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22205175 2012 Expression of ADAMTS-2, -3, -13, and -14 in culprit coronary lesions in patients with acute myocardial infarction or stable angina.
20574651 2010 ADAMTS-2 functions as anti-angiogenic and anti-tumoral molecule independently of its catalytic activity.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...