Property Summary

NCBI Gene PubMed Count 91
Grant Count 15
R01 Count 11
Funding $1,862,540.92
PubMed Score 224.14
PubTator Score 126.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
nephrosclerosis -1.806 0.015
osteosarcoma -1.824 0.000
posterior fossa group B ependymoma 1.500 0.000
medulloblastoma 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.660 0.025

Gene RIF (78)

PMID Text
26642098 ApoM is excreted in the urine of children after cardiac surgery in children with acute kidney injury
26377577 Hyperglycemia-induced downregulation of apolipoprotein M expression is not via the hexosamine pathway.
26057873 these findings demonstrated that apoM suppressed TNF-alpha-induced expression of ICAM-1 and VCAM-1 through inhibiting the activity of NF-kappaB.
25987835 our findings present supportive evidence that ApoM is a regulator of human LRH-1 transcription, and further reveal the importance of ApoM as a critical regulator of bile acids metabolism
25901639 ApoM is highly expressed in renal proximal tubule cells and is usually reabsorbed by giantin-associated proteins in a process, which is also affected in kidney disease.
25637426 -724 I/D polymorphism decreases the apoM promoter activity, down-regulates the apoM protein expression level, and increases the risk of myocardial infarction
25551802 role of apoM in lipid metabolism and cardiometabolic diseases.(48-55)
25194312 Binary logistic regression analysis suggested that both apoM and apoAI mRNA may considered as independent risk factors for fetal macrosomia
25187487 Single nucleotide polymorphism in APOM is associated with lung cancer.
25144649 ApoM overexpression may have a potential role in improving insulin resistance in vivo and modulating apoM expression might be a future therapeutic strategy against insulin resistance in type 2 diabetes.
More...

AA Sequence

MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIV      1 - 70
FNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQG     71 - 140
YQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN                          141 - 188
//

Text Mined References (93)

PMID Year Title
26642098 2016 Urinary apolipoprotein M as a biomarker of acute kidney injury in children undergoing heart surgery.
26377577 2015 Hyperglycemia-induced downregulation of apolipoprotein M expression is not via the hexosamine pathway.
26057873 2015 ApoM Suppresses TNF-?-Induced Expression of ICAM-1 and VCAM-1 Through Inhibiting the Activity of NF-?B.
25987835 2015 Apolipoprotein M regulates the orphan nuclear receptor LRH-1 gene expression through binding to its promoter region in HepG2 cells.
25901639 2015 Apolipoprotein M: Research progress, regulation and metabolic functions (Review).
25637426 2015 Functional study of -724I/D polymorphism in apolipoprotein M (apoM) gene promoter region and its association with myocardial infarction.
25551802 2015 Apolipoprotein M in lipid metabolism and cardiometabolic diseases.
25194312 2015 Increased mRNA levels of apolipoprotein M and apolipoprotein AI in the placental tissues with fetal macrosomia.
25187487 2014 Susceptibility loci for lung cancer are associated with mRNA levels of nearby genes in the lung.
25144649 2014 Intralipid decreases apolipoprotein M levels and insulin sensitivity in rats.
More...