Property Summary

NCBI Gene PubMed Count 28
Grant Count 12
R01 Count 5
Funding $377,989.21
PubMed Score 23.72
PubTator Score 16.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
25849655 SGK1.1 regulates gene transcription upon a different set of genes some of which participate in cell survival pathways (BAG-4) and others in intracellular vesicular traffic (Brox).
24737427 SODD over-expression might be correlated with the clinical classification, curative effect, and prognosis of ALL cells.
23190898 MicroRNA-26a is strongly downregulated in melanoma and induces cell death through repression of silencer of death domains (SODD).
20855536 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17605853 Vincristine induces Jurkat cell apoptosis by downregulating expression of SODD protein and priming the death receptor pathway.
17366557 results of analysis of the genome-wide scan data was a 20 cM region at 8p11-23 in which markers had LODs > or =1.0. Linkage and association analyses of these SNPs yield suggestive results for markers in FGFR1 and BAG4.
17178857 Gene induces transformed phenotype when overexpressed in a cancer breast cell line.
14559896 BAG-4 functions as a negative regulator for apobec-1-mediated apoB mRNA editing
More...

AA Sequence

MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGD      1 - 70
GYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTY     71 - 140
PPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPS    141 - 210
QNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPS    211 - 280
SGSPQSPPSPPVQQPKDSSYPYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGN    281 - 350
ATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL    351 - 420
LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL                                     421 - 457
//

Text Mined References (33)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25849655 2015 The neuronal-specific SGK1.1 (SGK1_v2) kinase as a transcriptional modulator of BAG4, Brox, and PPP1CB genes expression.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24737427 2014 Significance of SODD expression in childhood acute lymphoblastic leukemia and its influence on chemotherapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23190898 2013 MicroRNA-26a is strongly downregulated in melanoma and induces cell death through repression of silencer of death domains (SODD).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...