Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.17
PubTator Score 1.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.459 9.9e-05
atypical teratoid / rhabdoid tumor -2.000 3.9e-04
Breast cancer -2.900 3.4e-02
gastric carcinoma 2.000 2.4e-02
group 3 medulloblastoma -1.400 3.8e-02
head and neck cancer -1.300 7.0e-03
interstitial cystitis 2.600 7.8e-04
intraductal papillary-mucinous carcinoma... -1.300 4.8e-02
invasive ductal carcinoma -1.100 1.1e-02
medulloblastoma, large-cell -2.800 4.6e-04
osteosarcoma -1.486 4.6e-02
ovarian cancer -3.200 5.1e-11
pituitary cancer -2.200 2.7e-06
primary pancreatic ductal adenocarcinoma 1.153 2.6e-02
primary Sjogren syndrome 1.500 1.3e-02
primitive neuroectodermal tumor -2.100 3.0e-03
psoriasis -1.300 1.2e-18
subependymal giant cell astrocytoma 2.180 1.6e-02
ulcerative colitis 1.900 2.8e-04

Gene RIF (2)

AA Sequence

MRLLLLVPLLLAPAPGSSAPKVRRQSDTWGPWSQWSPCSRTCGGGVSFRERPCYSQRRDGGSSCVGPARS      1 - 70
HRSCRTESCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYSAPNKCELNCIPKGENFYYKHREAVVDGTP     71 - 140
CEPGKRDVCVDGSCRVVGCDHELDSSKQEDKCLRCGGDGTTCYPVAGTFDANDLSRGYNQILIVPMGATS    141 - 210
ILIDEAAASRNFLAVKNVRGEYYLNGHWTIEAARALPAASTILHYERGAEGDLAPERLHARGPTSEPLVI    211 - 280
ELISQEPNPGVHYEYHLPLRRPSPGFSWSHGSWSDCSAECGGGHQSRLVFCTIDHEAYPDHMCQRQPRPA    281 - 350
DRRSCNLHPCPETKRWKAGPWAPCSASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACN    351 - 420
LQRCAAWSPEPWGECSVSCGVGVRKRSVTCRGERGSLLHTAACSLEDRPPLTEPCVHEDCPLLSDQAWHV    421 - 490
GTWGLCSKSCSSGTRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQPCHLPQEVPSMQDVHTPASNPWMP    491 - 560
LGPQESPASDSRGQWWAAQEHPSARGDHRGERGDPRGDQGTHLSALGPAPSLQQPPYQQPLRSGSGPHDC    561 - 630
RHSPHGCCPDGHTASLGPQWQGCPGAPCQQSRYGCCPDRVSVAEGPHHAGCTKSYGGDSTGGMPRSRAVA    631 - 700
STVHNTHQPQAQQNEPSECRGSQFGCCYDNVATAAGPLGEGCVGQPSHAYPVRCLLPSAHGSCADWAARW    701 - 770
YFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQPGASGRSTHTDGGGSSPAGEQEPSQ    771 - 840
HRTGAAVQRKPWPSGGLWRQDQQPGPGEAPHTQAFGEWPWGQELGSRAPGLGGDAGSPAPPFHSSSYRIS    841 - 910
LAGVEPSLVQAALGQLVRLSCSDDTAPESQAAWQKDGQPISSDRHRLQFDGSLIIHPLQAEDAGTYSCGS    911 - 980
TRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQP    981 - 1050
RVVDASPGQRIRMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDGSLVISRVAVEDGGFYTCVAFNGQDR   1051 - 1120
DQRWVQLRVLGELTISGLPPTVTVPEGDTARLLCVVAGESVNIRWSRNGLPVQADGHRVHQSPDGTLLIY   1121 - 1190
NLRARDEGSYTCSAYQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCVDQPELANCDLILQAQLCGNEYYSS   1191 - 1260
FCCASCSRFQPHAQPIWQ                                                       1261 - 1278
//

Text Mined References (11)

PMID Year Title