Property Summary

NCBI Gene PubMed Count 36
PubMed Score 20.58
PubTator Score 25.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Leukemia, Myelocytic, Acute 113
Disease Target Count P-value
lung carcinoma 2844 2.73561962417635E-16
pilocytic astrocytoma 3086 8.6833651859064E-10
colon cancer 1475 8.21529725336805E-6
Breast cancer 3099 4.16340876386314E-5
atypical teratoid / rhabdoid tumor 4369 1.17379364395256E-4
osteosarcoma 7933 5.47990300169381E-4
COPD 116 8.63803256975961E-4
sonic hedgehog group medulloblastoma 1482 0.00106982628793711
Common variable immunodeficiency 98 0.00142738858082739
primitive neuroectodermal tumor 3031 0.00173761294391501
subependymal giant cell astrocytoma 2287 0.0042062779760175
dermatomyositis 967 0.00468762225085083
glioblastoma 5572 0.00848717504457474
pediatric high grade glioma 2712 0.0118414750010952
medulloblastoma, large-cell 6234 0.013056417519819
adrenocortical carcinoma 1427 0.0158987002978743
gastric carcinoma 832 0.0161376053946646
cutaneous lupus erythematosus 1056 0.0228596507585596
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0245289589249772
invasive ductal carcinoma 2950 0.0471481941470511
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Liver disease 219 0.0 1.0
Disease Target Count Z-score Confidence
Androgenic alopecia 10 3.046 1.5

Expression

 GO Function (1)

Gene RIF (18)

PMID Text
25684206 SVIL regulates neuronal maturation by controlling LSD1+8a mediated histone H3K9 demethylation.
25605665 These results position archvillin as a mechanically sensitive component of the dystrophin complex and demonstrate that signaling defects caused by loss of gamma-SG occur both at the sarcolemma and in the nucleus.
24088567 Supervillin concentrates activated and total myosin II at the furrow, and simultaneous knockdown of supervillin and anillin additively increases cell division failure.
23750008 An actin/myosin-II-binding protein, supervillin (SVIL), is a substrate of PLK1.
23382381 adhesion regulatory protein supervillin increases cell survival by decreasing levels of the tumor suppressor protein p53 and downstream target genes
22550155 Human genome-wide association and mouse knockout approaches identify platelet supervillin as an inhibitor of thrombus formation under shear stress.
21070852 supervillin is a novel molecule that associates with KIR2DL1 receptor and regulates the inhibitory signaling in NK cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20331534 supervillin, F-actin and associated proteins coordinate a rapid, basolateral membrane recycling pathway that contributes to ERK signaling and actin-based cell motility
20309963 Supervillin, like its interactors, is important for efficient cytokinesis.
More...

AA Sequence

MKRKERIARRLEGIENDTQPILLQSCTGLVTHRLLEEDTPRYMRASDPASPHIGRSNEEEETSDSSLEKQ      1 - 70
TRSKYCTETSGVHGDSPYGSGTMDTHSLESKAERIARYKAERRRQLAEKYGLTLDPEADSEYLSRYTKSR     71 - 140
KEPDAVEKRGGKSDKQEESSRDASSLYPGTETMGLRTCAGESKDYALHVGDGSSDPEVLLNIENQRRGQE    141 - 210
LSATRQAHDLSPAAESSSTFSFSGRDSSFTEVPRSPKHAHSSSLQQAASRSPSFGDPQLSPEARPSTGKP    211 - 280
KHEWFLQKDSEGDTPSLINWPSRVKVREKLVKEESARNSPELASESVTQRRHQPAPVHYVSFQSEHSAFD    281 - 350
RVPSKAAGSTRQPIRGYVQPADTGHTAKLVTPETPENASECSWVASATQNVPKPPSLTVLEGDGRDSPVL    351 - 420
HVCESKAEEEEGEGEGEEKEEDVCFTEALEQSKKTLLALEGDGLVRSPEDPSRNEDFGKPAVSTVTLEHQ    421 - 490
KELENVAQPPQAPHQPTERTGRSEMVLYIQSEPVSQDAKPTGHNREASKKRKVRTRSLSDFTGPPQLQAL    491 - 560
KYKDPASRRELELPSSKTEGPYGEISMLDTKVSVAQLRSAFLASANACRRPELKSRVERSAEGPGLPTGV    561 - 630
ERERGSRKPRRYFSPGESRKTSERFRTQPITSAERKESDRCTSHSETPTVDDEEKVDERAKLSVAAKRLL    631 - 700
FREMEKSFDEQNVPKRRSRNTAVEQRLRRLQDRSLTQPITTEEVVIAATEPIPASCSGGTHPVMARLPSP    701 - 770
TVARSAVQPARLQASAHQKALAKDQTNEGKELAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRID    771 - 840
TRQRRMNARYQTQPVTLGEVEQVQSGKLIPFSPAVNTSVSTVASTVAPMYAGDLRTKPPLDHNASATDYK    841 - 910
FSSSIENSDSPVRSILKSQAWQPLVEGSENKGMLREYGETESKRALTGRDSGMEKYGSFEEAEASYPILN    911 - 980
RAREGDSHKESKYAVPRRGSLERANPPITHLGDEPKEFSMAKMNAQGNLDLRDRLPFEEKVEVENVMKRK    981 - 1050
FSLRAAEFGEPTSEQTGTAAGKTIAQTTAPVSWKPQDSSEQPQEKLCKNPCAMFAAGEIKTPTGEGLLDS   1051 - 1120
PSKTMSIKERLALLKKSGEEDWRNRLSRRQEGGKAPASSLHTQEAGRSLIKKRVTESRESQMTIEERKQL   1121 - 1190
ITVREEAWKTRGRGAANDSTQFTVAGRMVKKGLASPTAITPVASPICGKTRGTTPVSKPLEDIEARPDMQ   1191 - 1260
LESDLKLDRLETFLRRLNNKVGGMHETVLTVTGKSVKEVMKPDDDETFAKFYRSVDYNMPRSPVEMDEDF   1261 - 1330
DVIFDPYAPKLTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSS   1331 - 1400
NSNFSEVTLAGLASKENFSNVSLRSVNLTEQNSNNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGD   1401 - 1470
CFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQTIEEGINTHTHAAKDFWKLLGGQ   1471 - 1540
TSYQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKE   1541 - 1610
VTLAQRKIAFQLAKHLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFL   1611 - 1680
DWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEIT   1681 - 1750
SVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRH   1751 - 1820
STVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEV   1821 - 1890
PVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSK   1891 - 1960
VTIHECDEGSEPLGFWDALGRRDRKAYDCMLQDPGSFNFAPRLFILSSSSGDFAATEFVYPARAPSVVSS   1961 - 2030
MPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCKGKNLKKPA   2031 - 2100
PKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEG   2101 - 2170
VDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF                             2171 - 2214
//

Text Mined References (47)

PMID Year Title
25684206 2015 A specific LSD1/KDM1A isoform regulates neuronal differentiation through H3K9 demethylation.
25605665 2015 Gamma-sarcoglycan is required for the response of archvillin to mechanical stimulation in skeletal muscle.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24088567 2013 Supervillin binding to myosin II and synergism with anillin are required for cytokinesis.
23750008 2013 The role of PLK1-phosphorylated SVIL in myosin II activation and cytokinetic furrowing.
23382381 2013 Supervillin-mediated suppression of p53 protein enhances cell survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22550155 2012 Human genome-wide association and mouse knockout approaches identify platelet supervillin as an inhibitor of thrombus formation under shear stress.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...