Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.89
PubTator Score 10.74

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMK      1 - 70
EHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLD     71 - 140
PAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSAS    141 - 210
TLQPPVAYILFPGMTKTGIDPYSSAHATAM                                            211 - 240
//

Text Mined References (14)

PMID Year Title