Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.98
PubTator Score 10.74

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
25973056 these results demonstrate that SOX14 can promote proliferation and invasion capacity of cervical cancer cells by activating the Wnt/beta-catenin pathway.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20074681 identified the positive control element and provided the first evidence that FOXA2 is involved in up-regulation of SOX14 expression in HepG2 and U87MG cell lines

AA Sequence

MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMK      1 - 70
EHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLD     71 - 140
PAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSAS    141 - 210
TLQPPVAYILFPGMTKTGIDPYSSAHATAM                                            211 - 240
//

Text Mined References (14)

PMID Year Title
25973056 2015 SOX14 promotes proliferation and invasion of cervical cancer cells through Wnt/?-catenin pathway.
25416956 2014 A proteome-scale map of the human interactome network.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20074681 Tissue-specific Forkhead protein FOXA2 up-regulates SOX14 gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194848 2002 Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families.
12100890 2002 Matching SOX: partner proteins and co-factors of the SOX family of transcriptional regulators.
10830911 2000 Fine mapping of the neurally expressed gene SOX14 to human 3q23, relative to three congenital diseases.
More...