Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $1,749,885
PubMed Score 37.58
PubTator Score 99.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
20538055 In the context of hepatocellular carcinoma cells, BRI3 is a target of WNT signaling.
19366692 BRI3 inhibits the various processing of amyloid protein precursor by blocking the access of alpha- and beta-secretases.
18452648 Possible roles of BRI3 in the process of neuronal differentiation.
17390049 BRI3 RNA is expressed less in stage 3 colon cancer in comparison to stage 2 colon cancer, and it is among 8 genes which can be used as a gene signature to differentiate colon cancer stages.
16508092 An X-ray data set was collected to 1.6 A resolution using synchrotron radiation, of a ligandin recombinant fusion protein.

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPAN      1 - 70
SIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA                    71 - 125
//

Text Mined References (14)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20538055 2010 Analysis of the Wnt/B-catenin/TCF4 pathway using SAGE, genome-wide microarray and promoter analysis: Identification of BRI3 and HSF2 as novel targets.
19366692 2009 BRI3 inhibits amyloid precursor protein processing in a mechanistically distinct manner from its homologue dementia gene BRI2.
18452648 2008 BRI3 associates with SCG10 and attenuates NGF-induced neurite outgrowth in PC12 cells.
17390049 2007 A gene signature of 8 genes could identify the risk of recurrence and progression in Dukes' B colon cancer patients.
16508092 2005 Crystallization and preliminary X-ray analysis of the GST-fused human Bri3 N-terminal domain.
16341674 2005 Transcriptome analysis of human gastric cancer.
15606899 2005 Beta-amyloid protein converting enzyme 1 and brain-specific type II membrane protein BRI3: binding partners processed by furin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14592447 2003 bri3, a novel gene, participates in tumor necrosis factor-alpha-induced cell death.
More...