Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.43
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95411 A2RRE2 Q6PEG2
Symbols MAJN
SPR210

Gene

Gene RIF (4)

AA Sequence

MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQR      1 - 70
VMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG                              71 - 115
//

Text Mined References (13)

PMID Year Title