Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.20
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
22534828 In vitro induction of TIAF1 self-association upregulated the expression of tumor suppressors Smad4 and WW domain-containing oxidoreductase (WOX1 or WWOX), and WOX1 in turn increased the TIAF1 expression.
21368882 TIAF1 undergoes self-aggregation in response to TGF-Beta1.
14965474 TIAF1 and p53 functionally interact in regulating apoptosis, and TIAF1 is likely to participate in the nuclear translocation of activated p53.
12829915 Expression of TIAF-1 in the lymphocytes during chronic allograft rejection may be related to the predominance of a Th2 response in this condition and may protect these cells from apoptosis

AA Sequence

MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQR      1 - 70
VMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG                              71 - 115
//

Text Mined References (13)

PMID Year Title
22534828 2012 TIAF1 self-aggregation in peritumor capsule formation, spontaneous activation of SMAD-responsive promoter in p53-deficient environment, and cell death.
21368882 2010 TGF-? induces TIAF1 self-aggregation via type II receptor-independent signaling that leads to generation of amyloid ? plaques in Alzheimer's disease.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15491607 2004 Alternative splice variants encoding unstable protein domains exist in the human brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14965474 2004 TIAF1 and p53 functionally interact in mediating apoptosis and silencing of TIAF1 abolishes nuclear translocation of serine 15-phosphorylated p53.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12829915 2003 High expression of TIAF-1 in chronic kidney and liver allograft rejection and in activated T-helper cells.
More...