Property Summary

NCBI Gene PubMed Count 40
Grant Count 47
R01 Count 41
Funding $4,700,419.71
PubMed Score 74.24
PubTator Score 68.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 GWAS Trait (1)

Gene RIF (29)

PMID Text
26426078 ZIC2 acts upstream of OCT4 and recruits the nuclear remodeling factor complex to the OCT4 promoter, initiating OCT4 activation. ZIC2 levels positively correlated to the clinicopathological stages of HCC patients.
26318045 Data show that Zinc finger protein ZIC 2 (ZIC2) is indispensable in the regulation of pancreatic ductal adenocarcinoma (PDAC) cell apoptosis.
24677696 Mutational screening for HPE genes revealed the occurrence of a frameshift mutation in the ZIC2 gene.
24150758 ZIC2 and RASGRF1 are susceptibility genes, not only for common myopia, but also for high myopia.
22859937 A high level of sequence variation in the 3'UTR of ZIC2 may be associated with holoprosencephaly.
22847929 The c.1401_1406dup (p.Ala469_470dup) or alanine tract expansion to 17 residues) in the ZIC2 gene are likely to be medically significant for holoprosencephaly in a Brazilian cohort.
22733541 ZIC2, a transcription factor related to the sonic hedgehog pathway, is a strong discriminant between MAL and LMP tumors: it may be a major determinant of outcome of EOTs.
22310223 Mutations in ZIC2 is associated with holoprosencephaly.
21940735 Brain malformations, including neuronal migration defects, predominated in individuals with ZIC2 mutations.
21908606 role for ZIC2 as a transcriptional regulator of the beta-catenin.TCF4 complex.
More...

AA Sequence

MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAFKLNPGAHELS      1 - 70
PGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFLFRSRGFGDSAPGGGQHGLFG     71 - 140
PGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQL    141 - 210
HNQYGPMNMNMGMNMAAAAAHHHHHHHHHPGAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTM    211 - 280
HELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENL    281 - 350
KIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ    351 - 420
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGSGSGGAGGGSG    421 - 490
GGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV                                491 - 532
//

Text Mined References (40)

PMID Year Title
26426078 2015 ZIC2-dependent OCT4 activation drives self-renewal of human liver cancer stem cells.
26318045 2015 Addiction of pancreatic cancer cells to zinc-finger transcription factor ZIC2.
25233373 2014 Genome-wide meta-analysis of myopia and hyperopia provides evidence for replication of 11 loci.
24677696 2014 Rare nasal cleft in a patient with holoprosencephaly due to a mutation in the ZIC2 gene.
24150758 2013 Association between ZIC2, RASGRF1, and SHISA6 genes and high myopia in Japanese subjects.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
22859937 2012 Unique alterations of an ultraconserved non-coding element in the 3'UTR of ZIC2 in holoprosencephaly.
22847929 2012 Comparison of mutation findings in ZIC2 between microform and classical holoprosencephaly in a Brazilian cohort.
22733541 2012 The zinc finger gene ZIC2 has features of an oncogene and its overexpression correlates strongly with the clinical course of epithelial ovarian cancer.
More...