Property Summary

NCBI Gene PubMed Count 127
PubMed Score 209.03
PubTator Score 169.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.535 1.8
Rheumatoid arthritis 1191 3.063 1.5

Expression

Gene RIF (117)

AA Sequence

MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTC      1 - 70
GPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEHASCPPGAGVIA     71 - 140
PGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLALNVPGSSSHDTLCTSCTGFPLSTRVPGAEE    141 - 210
CERAVIDFVAFQDISIKRLQRLLQALEAPEGWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQAL    211 - 280
RVARMPGLERSVRERFLPVH                                                      281 - 300
//

Text Mined References (127)

PMID Year Title