Property Summary

NCBI Gene PubMed Count 118
Grant Count 31
R01 Count 16
Funding $3,436,620.79
PubMed Score 198.16
PubTator Score 169.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (108)

PMID Text
26335204 Decoy receptor 3 (DcR3) expression in kidneys has been shown to predict progression of chronic kidney disease.
26238767 Decoy receptor 3 regulates the expression of tryptophan hydroxylase 1 in rheumatoid synovial fibroblasts
26062966 The sDcR3 levels in patients with HIV-1 subtype B were significantly higher than those in patients infected with subtype CRF01_AE. HIV-1 subtype B and slow disease progression were associated with higher levels of sDcR3.
25940317 DcR3 inhibits influenza a virus-induced JNK and ERK activation in human macrophages
25823874 tumour markers DcR3 and growth/differentiation factor (GDF)15 from 100 mul human serum, were quantified.
25647275 study has defined the increased serum and SF samples levels of TL1A and DcR3 in patients with rheumatoid arthritis (RA); findings support the hypothesis that TL1A and DcR3 may contribute to the pathogenesis of RA
25564309 Serum DcR3 expression in primary Sjogren's syndrome (pSS) patients was significantly higher than healthy controls. DcR3 expression in salivary glands of pSS patients was significantly higher than healthy controls.
25422191 Higher DcR3 expression was related to the status of invasion, lymph node metastasis and recurrence in bladder urothelial carcinoma.
25323840 decoy receptor 3 and geriatric nutrition have a role in mortality in chronic hemodialysis patients
25087510 Crystal structures of LIGHT and the LIGHT:DcR3 complex reveal the structural basis for the DcR3-mediated neutralization of LIGHT.
More...

AA Sequence

MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTC      1 - 70
GPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEHASCPPGAGVIA     71 - 140
PGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLALNVPGSSSHDTLCTSCTGFPLSTRVPGAEE    141 - 210
CERAVIDFVAFQDISIKRLQRLLQALEAPEGWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQAL    211 - 280
RVARMPGLERSVRERFLPVH                                                      281 - 300
//

Text Mined References (118)

PMID Year Title
26335204 2015 Expression of decoy receptor 3 in kidneys is associated with allograft survival after kidney transplant rejection.
26238767 2015 Decoy receptor 3 regulates the expression of tryptophan hydroxylase 1 in rheumatoid synovial fibroblasts.
26062966 2015 The serologic decoy receptor 3 (DcR3) levels are associated with slower disease progression in HIV-1/AIDS patients.
25940317 2015 DcR3 suppresses influenza virus-induced macrophage activation and attenuates pulmonary inflammation and lethality.
25823874 2015 Absolute quantification of DcR3 and GDF15 from human serum by LC-ESI MS.
25647275 2015 Serum and synovial fluid levels of tumor necrosis factor-like ligand 1A and decoy receptor 3 in rheumatoid arthritis.
25564309 2015 The expression of death decoy receptor 3 was increased in the patients with primary Sjögren's syndrome.
25422191 2014 Overexpression and clinicopathological contribution of DcR3 in bladder urothelial carcinoma tissues.
25416956 2014 A proteome-scale map of the human interactome network.
25323840 2014 Interaction between geriatric nutritional risk index and decoy receptor 3 predicts mortality in chronic hemodialysis patients.
More...