Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.92
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
invasive ductal carcinoma -1.100 6.0e-03
lung cancer 2.300 1.4e-03
Multiple myeloma 2.550 4.8e-05
osteosarcoma 2.456 1.3e-05
ovarian cancer -2.300 7.8e-05
pancreatic ductal adenocarcinoma liver m... -1.860 4.1e-04
psoriasis 1.900 4.5e-04
Waldenstrons macroglobulinemia 1.251 2.2e-02

Gene RIF (3)

AA Sequence

MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAA      1 - 70
EWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYV     71 - 140
LVSS                                                                      141 - 144
//

Text Mined References (11)

PMID Year Title