Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.09
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.251 0.022
Multiple myeloma 2.550 0.000
psoriasis 1.900 0.000
osteosarcoma 2.456 0.000
pancreatic ductal adenocarcinoma liver m... -1.860 0.000
lung cancer 2.300 0.001
invasive ductal carcinoma -1.100 0.006
ovarian cancer -2.800 0.000

Synonym

Accession O95406 Q3SYM7 CNIH-1
Symbols CNIH
CNIL
CNIH-1
TGAM77

Gene

Gene RIF (3)

PMID Text
23103966 Significant upregulation of CNIH-1 mRNA expression was found in schizophrenia.
22211840 the modulation of AMPA receptors by CNIH-2 depends upon the Transmembrane AMPA receptor regulatory protein isoform composition within the receptor complex
17607000 human CNIH and Drosophila Cni are primarily localized in the endoplasmic reticulum and associate with immature TGFalpha family proteins; alterations of cornichon expression result in changes in transport, processing and secretion of TGFalpha proteins

AA Sequence

MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAA      1 - 70
EWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYV     71 - 140
LVSS                                                                      141 - 144
//

Text Mined References (11)

PMID Year Title
23103966 2012 Upregulation of cornichon transcripts in the dorsolateral prefrontal cortex in schizophrenia.
22211840 2012 AMPA receptor modulation by cornichon-2 dictated by transmembrane AMPA receptor regulatory protein isoform.
17607000 2007 Cornichon regulates transport and secretion of TGFalpha-related proteins in metazoan cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
More...