Property Summary

NCBI Gene PubMed Count 34
Grant Count 250
R01 Count 148
Funding $51,571,883.13
PubMed Score 122.89
PubTator Score 262.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
osteosarcoma 1.530 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.300 0.001
primitive neuroectodermal tumor -1.100 0.004
interstitial cystitis -1.200 0.001
lung adenocarcinoma -1.500 0.000
adult high grade glioma -1.200 0.000

Synonym

Accession O95405 Q5T0F6 Q5T0F7 Q9UNE1 Q9Y5R7
Symbols NSP
SARA
MADHIP
SMADIP
PPP1R173

Gene

PANTHER Protein Class (1)

PDB

1MK2   1DEV   4BKW  

Gene RIF (16)

PMID Text
26358513 we have identified endofin as an important signalling component required for basal and BMP-induced hepcidin expression.
26159183 SARA may serve as a potential novel target in pre-Epithelial-mesenchymal transition states for the amelioration renal fibrosis seen in chronic kidney diseases
25614622 PI3K-C2a was also required for TGFb receptor-mediated formation of SARA-Smad2/3 complex
25496667 Genome-wide shRNA screening identifies ZFYVE9, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23222715 The negative influence that perturbation of RNF11 and SARA levels exerts on the lysosomal degradation of EGFRs could underscore the significance of overexpression of RNF11 in certain cancers.
22942286 TGF-beta1 can induce epithelial-to-mesenchymal transition through reduction in SARA expression, SARA is also basally regulated by its interaction with PI3K.
22819827 no correlation between SARA expression and the levels of TGF-beta1-induced phosphorylation of Smads in various B-cell lymphomas
21878490 SARA binds to ERBIN using a new domain, which we have called the ERBID (ERBIN-binding domain)
21200089 After stimulation with glucose, expression of SARA decreased in a time-dependent manner in epithelium to mesenchymal transition of proximal tubule cells.
19620243 SARA has a role in regulating cell phenotype and its effects are mediated through modification of the balance between Smad2 and Smad3 signaling
More...

AA Sequence

MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESAVSNESQPQLK      1 - 70
VFSLAHSAPLTTEEEDHCANGQDCNLNPEIATMWIDENAVAEDQLIKRNYSWDDQCSAVEVGEKKCGNLA     71 - 140
CLPDEKNVLVVAVMHNCDKRTLQNDLQDCNNYNSQSLMDAFSCSLDNENRQTDQFSFSINESTEKDMNSE    141 - 210
KQMDPLNRPKTEGRSVNHLCPTSSDSLASVCSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPA    211 - 280
VKKQENYIPDEDLTGKISSPRTDLGSPNSFSHMSEGILMKKEPAEESTTEESLRSGLPLLLKPDMPNGSG    281 - 350
RNNDCERCSDCLVPNEVRADENEGYEHEETLGTTEFLNMTEHFSESQDMTNWKLTKLNEMNDSQVNEEKE    351 - 420
KFLQISQPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSF    421 - 490
VPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNEATEGSGLLLNSTGDLMKKNYLHNFCSQVPSVLGQ    491 - 560
SSPKVVASLPSISVPFGGARPKQPSNLKLQIPKPLSDHLQNDFPANSGNNTKNKNDILGKAKLGENSATN    561 - 630
VCSPSLGNISNVDTNGEHLESYEAEISTRPCLALAPDSPDNDLRAGQFGISARKPFTTLGEVAPVWVPDS    631 - 700
QAPNCMKCEARFTFTKRRHHCRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVLMNAQAWENMMSAS    701 - 770
SQSPNPNNPAEYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGAEVAQPREQRRVWFADGILPNGEV    771 - 840
ADAAKLTMNGTSSAGTLAVSHDPVKPVTTSPLPAETDICLFSGSITQVGSPVGSAMNLIPEDGLPPILIS    841 - 910
TGVKGDYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNYVNRKCWCFTTKGMHAVGQSEIVI    911 - 980
LLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVSNLGHSFFSQSFLGSKEHGGFLYVTSTYQSLQDLVLPT    981 - 1050
PPYLFGILIQKWETPWAKVFPIRLMLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTL   1051 - 1120
PVVQGLVVDMEVRKTSIKIPSNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISI   1121 - 1190
HNQPRKVTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEP   1191 - 1260
QEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLENDDQHNCLSDPA   1261 - 1330
DHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSNGQPLPSQYMNDLDSALVPVI   1331 - 1400
HGGACQLSEGPVVMELIFYILENIV                                                1401 - 1425
//

Text Mined References (39)

PMID Year Title
26358513 2015 Endofin, a novel BMP-SMAD regulator of the iron-regulatory hormone, hepcidin.
26159183 2015 Smad Anchor for Receptor Activation Regulates High Glucose-Induced EMT via Modulation of Smad2 and Smad3 Activities in Renal Tubular Epithelial Cells.
25614622 2015 Phosphatidylinositol 3-kinase class II ?-isoform PI3K-C2? is required for transforming growth factor ?-induced Smad signaling in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23222715 2013 SARA and RNF11 interact with each other and ESCRT-0 core proteins and regulate degradative EGFR trafficking.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22942286 2012 Phosphatidylinositol 3-kinase and Rab5 GTPase inversely regulate the Smad anchor for receptor activation (SARA) protein independently of transforming growth factor-?1.
22819827 2012 SARA is dispensable for functional TGF-? signaling.
More...