Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.33
PubTator Score 10.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.174 3.3e-03

Gene RIF (9)

AA Sequence

MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELA      1 - 70
KRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGPPRSIHDLKSRNDLQRLPGQR     71 - 140
LDRLGSRKRRGDQRDLGHPGPPPKVSKASHDPLVPNSSPLPTNGISGSPESFASSLDGSGHAGPEGSRLE    141 - 210
RDENDKHSGKIPVNAVRPHTSSPGLGKPPGPCLQPKASVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRH    211 - 280
EGSFARQQSLYAPKGSVPSPSPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQR    281 - 350
LAGPGCKAGLSPAEPLLSRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRL    351 - 420
KERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYL    421 - 490
SRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQW    491 - 560
PGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD                                  561 - 600
//

Text Mined References (19)

PMID Year Title