Property Summary

NCBI Gene PubMed Count 31
PubMed Score 82.63
PubTator Score 29.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 1.8e-03
osteosarcoma -1.233 6.9e-07
ovarian cancer 1.500 3.3e-05

Gene RIF (5)

AA Sequence

MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEEEDDDDGGSSKYDILASED      1 - 70
VEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASD     71 - 140
SEEEDSLGQTSMSAQALLEGLLELLLPRETVAGALRRLGARGGGKGRKGPGQPSSPQRLDRLSGLADQMV    141 - 210
ARGNLGVYQETRERLAMRLKGLGCQTLGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVD    211 - 280
VMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT             281 - 341
//

Text Mined References (44)

PMID Year Title