Property Summary

NCBI Gene PubMed Count 94
Grant Count 11
R01 Count 6
Funding $1,040,280.6
PubMed Score 395.85
PubTator Score 375.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma -2.400 0.027
osteosarcoma -2.570 0.000
glioblastoma 1.200 0.010
tuberculosis 2.500 0.035
psoriasis 1.300 0.000

Gene RIF (83)

PMID Text
27090416 Our study suggests that U-II may play a role in migraine pathogenesis; also Thr21Met polymorphism was associated with the risk of migraine disease.
26658815 Urotensin II-increased reactive oxygen species production via the NADPH oxidase pathway is partially associated with activation of the PI3K/Akt and ERK cascades
26640798 Used transgenic rabbits as a model to study macrophage-specific expressing human UII (hUII) and studied the role of autocrine UII in the development of atherosclerosis.
25880595 expression of UII is associated with ERS in patients with SPE. Our results indicate that UII may trigger ERS in placental trophoblastic cells in patients with preeclampsia.
25648034 Study suggests that soluble CD40 ligand and urotensin II likely play a role in the pathogenesis of slow coronary flow.
25604143 enzyme-linked immunosorbent assay (ELISA) and restriction fragment length polymorphism analysis were used to evaluate plasma levels of urotensin-II and Thr21Met and Ser89Asn polymorphisms of UTS2 gene in breast cancer patients.
25597409 provide evidence that, in glioma cells, homogeneous concentration of UII allowed translocation of Galpha13 to the UT receptor at the plasma membrane and increased actin stress fibers, lamellipodia formation and vinculin-stained focal adhesions
25514221 Urotensin II can induce the proliferation of BEL-7402 cells via the urotensin receptor mediated PKC/ERK/p38 MAPK signaling pathways.
25268131 Urotensin-II induces activating transcription factor 3 (ATF3) at both mRNA and protein levels.
25134283 Elevation or urotensin II in the serum of preeclampsia patients could be corrected to the severity and/or progression of the disease. The urotensin genotype frequency between patients and control groups showed a significant difference.
More...

AA Sequence

MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRK      1 - 70
ADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV                     71 - 124
//

Text Mined References (94)

PMID Year Title
27090416 2016 Plasma urotensin-2 level and Thr21Met but not Ser89Asn polymorphisms of the urotensin-2 gene are associated with migraines.
26658815 2015 Urotensin-II-Mediated Reactive Oxygen Species Generation via NADPH Oxidase Pathway Contributes to Hepatic Oval Cell Proliferation.
26640798 2015 Autocrine Human Urotensin II Enhances Macrophage-Derived Foam Cell Formation in Transgenic Rabbits.
25880595 2016 Expression levels of urotensin II are associated with endoplasmic reticulum stress in patients with severe preeclampsia.
25648034 2014 Coronary slow flow phenomenon associated with high serum levels of soluble CD40 ligand and urotensin II: a multi-marker approach.
25604143 2015 The role of the UTS2 gene polymorphisms and plasma Urotensin-II levels in breast cancer.
25597409 2015 Signaling switch of the urotensin II vasosactive peptide GPCR: prototypic chemotaxic mechanism in glioma.
25514221 2014 Up-regulation of urotensin II and its receptor contributes to human hepatocellular carcinoma growth via activation of the PKC, ERK1/2, and p38 MAPK signaling pathways.
25268131 2014 Urotensin II inhibits doxorubicin-induced human umbilical vein endothelial cell death by modulating ATF expression and via the ERK and Akt pathway.
25134283 2014 Study of urotensin II gene and serum levels in relation to pre-eclampsia.
More...