Property Summary

NCBI Gene PubMed Count 138
PubMed Score 376.03
PubTator Score 277.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03
Astrocytoma, Pilocytic -1.100 1.4e-06
atypical teratoid / rhabdoid tumor -1.500 3.0e-07
Breast cancer -2.500 3.1e-02
Chronic Lymphocytic Leukemia 1.749 1.3e-07
diabetes mellitus 1.200 2.3e-03
ductal carcinoma in situ -1.500 5.5e-05
glioblastoma -1.200 1.6e-04
group 3 medulloblastoma -1.300 2.2e-03
invasive ductal carcinoma -1.700 2.6e-04
lung adenocarcinoma -1.100 6.3e-09
medulloblastoma, large-cell -1.500 1.3e-04
non-small cell lung cancer -1.232 3.4e-28
osteosarcoma -1.989 1.5e-04
ovarian cancer 1.300 2.0e-06
primitive neuroectodermal tumor -1.200 8.8e-05
psoriasis -1.100 5.3e-03

Gene RIF (124)

AA Sequence

MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLLEHQRPSCIQG      1 - 70
LRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGIL     71 - 140
ALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVRTHEMEEELAEAVALLSQ    141 - 210
RGPDALLTVALRKPPGQRTDEELDLIFEELLHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKG    211 - 280
TSWYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVE    281 - 350
AKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD    351 - 420
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFL    421 - 490
QKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKV    491 - 560
PYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERL    561 - 630
FVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVT    631 - 700
TANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLA    701 - 770
HTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE    771 - 840
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDN    841 - 910
QRELSRLSRELEP                                                             911 - 923
//

Text Mined References (139)

PMID Year Title