Property Summary

NCBI Gene PubMed Count 127
Grant Count 254
R01 Count 191
Funding $27,145,232.58
PubMed Score 340.75
PubTator Score 277.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.749 0.000
psoriasis -1.100 0.005
osteosarcoma -1.989 0.000
medulloblastoma -1.300 0.000
atypical teratoid/rhabdoid tumor -1.600 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.200 0.000
non-small cell lung cancer -1.232 0.000
diabetes mellitus 1.200 0.002
Breast cancer -2.500 0.031
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000
lung adenocarcinoma -1.100 0.000
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -1.700 0.000
ovarian cancer 1.300 0.000

Synonym

Accession O95398 A8K2G5 E7EQC8 O95634 Q8WVN0
Symbols EPAC
EPAC1
bcm910
HSU79275
CAMP-GEFI

Gene

Gene RIF (113)

PMID Text
26979996 EPAC activity is increased in arterial endothelial cells exposed to laminar-fluid shear stress, activation of EPAC1, and its activation of Rap1, plays a role in promoting alignment and elongation of these cells in the direction of flow.
26589262 The cAMP exerted divergent effects on proliferation and promoted cell adhesion of different neuroendocrine cell types, these effects being mediated by both Epac and PKA and involving the same effector GTPase Rap1.
26388312 EPAC activation consistently reverses clinical and experimental impairment of neutrophil phagocytosis. EPAC signals through Rap-1 and bypasses RhoA. EPAC activation represents a novel potential means by which to reverse impaired neutrophil phagocytosis.
26119090 findings, coupled with the development of EPAC specific small molecule modulators, validate EPAC1 as a promising target for therapeutic interventions
25955407 Impaired microtubule dynamics, due to reduced EPAC1 signaling, links CFTR function to cystic fibrosis cellular events.
25913012 association of ezrin with the actin cytoskeleton and phosphorylation on Thr567 are required, but not sufficient, for PKA and EPAC1 to synergistically promote cell spreading following elevations in intracellular cAMP.
25683912 Identified a conserved nuclear pore localisation signal (NPLS; amino acids 764-838 of EPAC1) in the catalytic domains of the cAMP-sensors, EPAC1 and EPAC2A. EPAC1 and EPAC2, display distinct subcellular distributions.
25406016 prostacyclin regulates bone growth via the Epac/Rap1 pathway
25372777 Thyroid carcinoma cell lines showed no or very weak EPAC1 expression and exhibited no growth-promoting effect after EPAC stimulation.
25159528 Sequestration of sperm Rab27 prevents subsequent cAMP/Epac-dependent calcium mobilization from the acrosome.
More...

AA Sequence

MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLLEHQRPSCIQG      1 - 70
LRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGIL     71 - 140
ALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVRTHEMEEELAEAVALLSQ    141 - 210
RGPDALLTVALRKPPGQRTDEELDLIFEELLHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKG    211 - 280
TSWYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVE    281 - 350
AKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD    351 - 420
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFL    421 - 490
QKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKV    491 - 560
PYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERL    561 - 630
FVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVT    631 - 700
TANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLA    701 - 770
HTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE    771 - 840
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDN    841 - 910
QRELSRLSRELEP                                                             911 - 923
//

Text Mined References (128)

PMID Year Title
26979996 2016 EPAC1 promotes adaptive responses in human arterial endothelial cells subjected to low levels of laminar fluid shear stress: Implications in flow-related endothelial dysfunction.
26589262 2015 cAMP effects in neuroendocrine tumors: The role of Epac and PKA in cell proliferation and adhesion.
26388312 2016 Exchange protein directly activated by cyclic AMP (EPAC) activation reverses neutrophil dysfunction induced by ?2-agonists, corticosteroids, and critical illness.
26119090 2015 Exchange protein directly activated by cAMP encoded by the mammalian rapgef3 gene: Structure, function and therapeutics.
25955407 2015 Role of Exchange Protein Activated by cAMP 1 in Regulating Rates of Microtubule Formation in Cystic Fibrosis Epithelial Cells.
25913012 2015 Phosphorylation of ezrin on Thr567 is required for the synergistic activation of cell spreading by EPAC1 and protein kinase A in HEK293T cells.
25683912 2015 The cAMP sensors, EPAC1 and EPAC2, display distinct subcellular distributions despite sharing a common nuclear pore localisation signal.
25406016 2015 Prostacyclin regulates bone growth via the Epac/Rap1 pathway.
25372777 2015 Expression of the cAMP binding protein EPAC1 in thyroid tumors and growth regulation of thyroid cells and thyroid carcinoma cells by EPAC proteins.
25159528 2014 Epac, Rap and Rab3 act in concert to mobilize calcium from sperm's acrosome during exocytosis.
More...