Property Summary

NCBI Gene PubMed Count 5
PubMed Score 11.67

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0

AA Sequence

VAALTVKEGDHRKEAFSIGMQRDLSLYLPAMKKQMAILDAL                                 351 - 391

Text Mined References (7)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11001876 2000 Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.