Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.92
PubTator Score 9.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.082 8.3e-05

Protein-protein Interaction (8)

Gene RIF (9)

AA Sequence

MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLP      1 - 70
ELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFS     71 - 140
AAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEG    141 - 210
QITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDA    211 - 280
LRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAF    281 - 350
HLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK    351 - 420
AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY                                  421 - 460
//

Text Mined References (19)

PMID Year Title