Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $285,024.2
PubMed Score 9.93
PubTator Score 9.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.082 0.000

Synonym

Accession O95396
Symbols UBA4

Gene

PANTHER Protein Class (1)

PDB

3I2V  

Gene RIF (7)

PMID Text
25747390 ubiquitin-like Urm1.Uba4 systems are conserved and exchangeable between human and yeast cells
22453920 extension of the C terminus with an additional glycine of MOCS2A and URM1 altered the localization of MOCS3 from the cytosol to the nucleus.
18650437 Nfs1 acts as a sulfur donor for MOCS3, a protein involved in molybdenum cofactor biosynthesis
18491921 The UBA4-URM1 system represents the evolutionary link between protein conjugation and protein modification by sulfur carrier proteins.
17459099 in humans & most eukaryotes thiosulfate is not physiologic sulfur donor for MOCS3, whereas in bacterial homologs, which have arginine at last position of active site loop, thiosulfate can be used as a sulfur source for molybdenum cofactor biosynthesis.
15910006 Electrospray ionization mass spectrometry performed on a rhodanese-like carboxyl-terminal domain of human MOCS3 provides direct evidence for the formation of persulfide on cysteine residue 412.
15073332 MOCS3 protein is believed to catalyze both the adenylation and the subsequent generation of a thiocarboxylate group at the C terminus of the smaller subunit of molybdopterin synthase

AA Sequence

MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLP      1 - 70
ELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFS     71 - 140
AAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEG    141 - 210
QITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDA    211 - 280
LRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAF    281 - 350
HLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK    351 - 420
AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY                                  421 - 460
//

Text Mined References (16)

PMID Year Title
25747390 2015 Urmylation and tRNA thiolation functions of ubiquitin-like Uba4·Urm1 systems are conserved from yeast to man.
22453920 2012 Dual role of the molybdenum cofactor biosynthesis protein MOCS3 in tRNA thiolation and molybdenum cofactor biosynthesis in humans.
21269460 2011 Initial characterization of the human central proteome.
19017811 2008 A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway.
18650437 2008 A novel role for human Nfs1 in the cytoplasm: Nfs1 acts as a sulfur donor for MOCS3, a protein involved in molybdenum cofactor biosynthesis.
18491921 2008 The sulfurtransferase activity of Uba4 presents a link between ubiquitin-like protein conjugation and activation of sulfur carrier proteins.
17459099 2007 Site-directed mutagenesis of the active site loop of the rhodanese-like domain of the human molybdopterin synthase sulfurase MOCS3. Major differences in substrate specificity between eukaryotic and bacterial homologs.
15910006 2005 Molybdenum cofactor biosynthesis in humans: identification of a persulfide group in the rhodanese-like domain of MOCS3 by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
More...