Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 2
Funding $681,053.65
PubMed Score 24.22
PubTator Score 20.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession O95395
Symbols GNTM
C24GNT
C2GNT2
C2GNTM
C2/4GnT

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
25701318 This study provides the concepts toward the design of carbohydrate-dependent inhibition of EPEC and EHEC O157:H7 adhesion to human intestinal epithelial cells.
25605727 In HeLa cells transiently expressing C2GnT-M-GFP, knockdown of KRT1 does not affect Golgi morphology but leaves C2GnT-M outside of the Golgi, resulting in the formation of sialyl-T antigen.
25466507 low GCNT3 expression is a promising prognostic biomarker for colon cancer that could be used to identify early-stage colon cancer patients at high risk of relapse.
23396488 Golgi fragmentation is accompanied by the increased association of NMIIA with C2GnT-M and its degradation by proteasomes.
22988244 Data show that the Golgi docking of vesicular complexes (VCs) use different golgins for docking: C2GnT-M-carrying VC (C2GnT-M-VC) utilizes Giantin, whereas C1GalT1-VC employs GM130-GRASP65 complex.
22082156 Knockdown of glucosaminyl (N-acetyl) transferase 3, mucin type (GCNT3) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20816165 C2GnT2 KO mice have decreased mucosal barrier function in the digestive tract, reduced levels of circulating IgGs and fecal IgA, and increased susceptibility to experimental colitis
17303715 Results describe the identification of the cis-regulatory elements of human C2GnT-M gene.
16418723 Frequently downregulated in colorectal cancer and suppresses colon cancer cell growth.
12600830 EGF suppressed C2GnT activity in a time- and dose-dependent fashion, and also suppressed core 4 beta1,6 N-acetylglucosaminyltransferase (C4GnT) activity

AA Sequence

MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINC      1 - 70
SGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSKEEVEFPIAYSMVIH     71 - 140
EKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCM    141 - 210
EDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTN    211 - 280
KKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHP    281 - 350
KYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNA    351 - 420
LQCLEEYLRYKAIYGTEL                                                        421 - 438
//

Text Mined References (17)

PMID Year Title
25701318 2015 Core 2 Mucin-Type O-Glycan Is Related to EPEC and EHEC O157:H7 Adherence to Human Colon Carcinoma HT-29 Epithelial Cells.
25605727 2015 Keratin 1 plays a critical role in golgi localization of core 2 N-acetylglucosaminyltransferase M via interaction with its cytoplasmic tail.
25466507 2015 Clinical relevance of the differential expression of the glycosyltransferase gene GCNT3 in colon cancer.
23396488 2013 A non-enzymatic function of Golgi glycosyltransferases: mediation of Golgi fragmentation by interaction with non-muscle myosin IIA.
22988244 2012 Glycosyltransferase-specific Golgi-targeting mechanisms.
20816165 2010 Characterization of mice with targeted deletion of the gene encoding core 2 beta1,6-N-acetylglucosaminyltransferase-2.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17303715 2007 Mucin biosynthesis: identification of the cis-regulatory elements of human C2GnT-M gene.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16418723 2006 C2GnT-M is downregulated in colorectal cancer and its re-expression causes growth inhibition of colon cancer cells.
More...