Property Summary

NCBI Gene PubMed Count 15
PubMed Score 25.47
PubTator Score 20.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis 1.423 2.2e-02
colon cancer -1.700 3.8e-02
esophageal adenocarcinoma 2.600 2.3e-02
intraductal papillary-mucinous neoplasm ... 2.700 3.0e-02
lung adenocarcinoma 2.100 2.5e-08
nasopharyngeal carcinoma -1.800 3.9e-04
non-small cell lung cancer 1.535 6.2e-08
pancreatic cancer 2.500 1.6e-06
primary pancreatic ductal adenocarcinoma 3.250 4.8e-03
Rhinitis 1.100 2.4e-02
spina bifida -2.364 4.3e-02
uncontrolled asthma 1.700 5.0e-03

Protein-protein Interaction (6)

Gene RIF (10)

AA Sequence

MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINC      1 - 70
SGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSKEEVEFPIAYSMVIH     71 - 140
EKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCM    141 - 210
EDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTN    211 - 280
KKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHP    281 - 350
KYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNA    351 - 420
LQCLEEYLRYKAIYGTEL                                                        421 - 438
//

Text Mined References (17)

PMID Year Title